(data stored in ACNUC27125 zone)

EMBL: CP000828.PE158

CP000828.PE158       Location/Qualifiers
FT   CDS_pept        complement(162278..163030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25249"
FT                   /db_xref="GOA:B0C7I9"
FT                   /db_xref="InterPro:IPR007715"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7I9"
FT                   /protein_id="ABW25249.1"
FT                   /translation="MGFKYINEIATPDNINQLLTFIDHVAGAGTDVNEVFDISDLLRDS
FT                   PQMERCLTWMREDAATAQMIEAQYLGSEYDLEKMLQMPEGSLGWTYARVMSALGYEPHF
FT                   YRLRNIEKDADYVINRIRKTHDLHHILTGFSMDDFGEAGVLSVTVAQTGYPGWILINLL
FT                   GMLLDFFGGPQDNGIDVEYDYDILSTGIKIGRDAKPLFPVKWEERFEQPLDDLRSEFNI
FT                   QPVTEGQWSWYSRPQLRDAIALTEPTAV"
     atggggttca aatatatcaa tgaaattgcc acacctgaca atatcaacca gctattgacc        60
     tttattgatc atgttgccgg ggccgggacg gatgtgaatg aggtatttga tattagcgac       120
     ttgctgcgag atagtcccca aatggagcgc tgtctgacct ggatgagaga agatgcagcg       180
     actgctcaaa tgattgaagc gcaatatttg ggttcagagt atgacttgga gaaaatgttg       240
     cagatgccgg aaggatcatt agggtggacc tatgcccgag taatgagtgc attgggatac       300
     gagccccact tctatcgcct acgcaatatt gaaaaggatg cagattatgt aatcaatcgc       360
     attcgtaaaa cccatgattt acatcatatt ttgacgggct ttagcatgga tgactttggt       420
     gaagcgggtg tcctgtctgt taccgttgcc cagacgggct atcccggttg gatattgatc       480
     aatcttctgg gtatgttgct ggactttttt ggtggtcccc aagataacgg tatcgatgtt       540
     gaatatgact atgacatctt gtctacgggc atcaagatag gacgagacgc aaagcctctg       600
     ttccccgtga agtgggaaga acggttcgaa cagcccctag atgacttgcg gtctgagttc       660
     aatatccagc cagttacgga aggacagtgg agttggtata gccgtcctca acttcgggat       720
     gcgatcgcac tgacagaacc gaccgctgtt taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page