(data stored in ACNUC27125 zone)

EMBL: CP000828.PE159

CP000828.PE159       Location/Qualifiers
FT   CDS_pept        complement(163392..163829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25250"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7J0"
FT                   /protein_id="ABW25250.1"
FT                   /translation="MFSFSIALLIILNLEKIMTTSSPITPVSEETRALVNQKMANESDE
FT                   IKQKAGELVDLIKKRAESELSAADQITRETYHQAISQAKATLNQTETFFQEQGNALDQS
FT                   LKELNDDASRKWDTFVAELKGMGDRFDKAVNSAWAALIKES"
     ttgttttcct tctcaatcgc tttgctcatt attcttaatt tggagaaaat catgactact        60
     tcttccccaa tcactcccgt cagcgaagaa acccgagccc tagttaatca aaagatggcg       120
     aatgagtcag atgagattaa gcaaaaagcc ggcgagttgg tcgacttaat taaaaagcgg       180
     gccgaatctg aactttctgc tgctgaccaa atcacccgtg aaacctatca tcaggccatc       240
     agccaagcga aggcaaccct caatcaaaca gaaacctttt tccaagaaca aggcaatgct       300
     ttggatcagt ctcttaaaga actcaatgat gatgccagtc gcaaatggga cacctttgtg       360
     gctgaactca aaggcatggg agatcgcttc gataaagccg tgaattctgc ttgggctgcc       420
     ttgattaagg agtcatag                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page