(data stored in ACNUC5340 zone)

EMBL: CP000828.PE160

CP000828.PE160       Location/Qualifiers
FT   CDS_pept        164176..167778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0165"
FT                   /product="WD-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25251"
FT                   /db_xref="GOA:B0C7J1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7J1"
FT                   /protein_id="ABW25251.1"
FT                   /translation="MIAVDALAVLEKTLPPGTLNQVKTLVFKQAWDGKGYAEIAEEAGY
FT                   DTDYIKSVAAQLWKSISSELGEKVTKTNFRSLLIQRLDKSDVSEDSLVQPPIAEDSTPL
FT                   PSGIANEKAPVVDWGEAPDVSKFYGRNEELAQISTCNLTEGCRLVAVLGMGGMGKTSLI
FT                   AKLAQQVQHHYDFVIWRSLRNAPTADEVIAELIPFLSEQQSDQCSTRQLVQCLRASKCL
FT                   IIFDNLESILQAGQVGYYRPGYEEYGNLLRVVGETAHQSCLLLTSREKPPEVAELEGLD
FT                   LAVRSFSLRGSSEVATALLNAKGIEGSPEQQQQLSHHYGGSPLALKIIASSIQDLFEGN
FT                   LEDFLAQETVAFNGIRRLLDQQFKRLSPLEKVILNWLAINREWTSIAELQRDIVPTVSM
FT                   ASLLESLEALTWRNLIEKNVSRQGQSGQYTLQPVVMEYVTNDLVQQVYQDLMEDTDSQG
FT                   VQRQGLTSSQSYFHTHALLKTTVKDYIQDSQKRLILEPLAQLLRNTFFSAPMLAQWVQS
FT                   VLNQLHTSPVTGYGPGNLINLCRQLKLDLTGYDFSQLPIWQANLRDMSLPQVNFKGANF
FT                   QQTLFTQSLSGILNIAYSPKGDFLATIDATGSVRLWQVADGQLHMSFEDHSYWGWALAF
FT                   SPDGQQLASGGEDNMVRVWDVTTGQCINSLELKCNVVWTVAFSPNGQTLAIGTSDTDIL
FT                   LWDLERNQLPEVLQGHTSDVRSLQFSPDGQQLVSASHDHTLKIWNLQSGKCQQTCVGHS
FT                   EWVLSVAYSIDGQTLASGSADRTVRLWDVKTGQCRQTLSGHDLMVTAIAFSPDGQHIAS
FT                   ASEDRTVRVWDVRGQHLKTLVGHLHWVWSVAFSPDGQMLASGGSDQTVRFWHVQTGRPL
FT                   KTLAGYIDYSYALAWLPDGQALLSGSSNHTIRTWEQGRCRQTWKAHENWVWSVSCRPDG
FT                   QVLASGSNAVKLWDMETNACIATLQEDEGFVFCLAWSPNGRYFATGSSDHRVRIWKADT
FT                   QRCLQLLEGHEGWVFQVAWSPNGQSLASCGVDGTANVWNIKTGDCLQTFHEDNWIWSVV
FT                   WSPDHRFLAYSTADGNIKFWDTKTWKLLQTLTGHTAQVTRIDFSPSGRRLASGSYDLTI
FT                   KIWDVETGNCQQTLTGHTQIITNLVFNPVETDNSCLLASASEDETLRIWNILSGECQHV
FT                   LRPEGPYEGMNVADTSGLTPAQIKSLQSLGAVTG"
     ttgattgctg tagatgctct ggctgttcta gaaaaaaccc tgccccccgg aacactcaac        60
     caagttaaaa cattggtgtt taagcaagcc tgggacggta aaggctatgc agaaattgct       120
     gaagaggctg gctacgatac ggactatata aaaagtgtgg ccgctcaact ttggaaaagc       180
     atttcctcag aactaggcga aaaagtcacc aaaacaaatt ttcggtcctt attgattcag       240
     cgattggaca aatctgatgt cagtgaggat tcactagttc aaccacctat cgcagaggac       300
     tctaccccac ttccttcagg tatagccaat gagaaagccc ctgttgtgga ctggggcgaa       360
     gcccccgatg tctctaaatt ttatggccgt aatgaagaac ttgcccaaat ttctacctgt       420
     aatctgaccg aggggtgtcg attagtggcc gtgttgggca tgggagggat gggcaaaacg       480
     agcttaatcg caaagctggc ccagcaggtc caacatcact acgattttgt gatttggcga       540
     tccctccgca acgcgccaac agcagacgag gtcattgcag aactgatccc ctttctgtct       600
     gagcaacaat ccgatcaatg ctcgacccgc caactggtgc aatgtctgcg agcctctaaa       660
     tgcttgatca tattcgacaa tctggagtcg attctccagg ctggacaagt gggatactac       720
     cgcccaggct atgaagaata tgggaatcta cttcgggttg tgggagaaac ggctcaccaa       780
     agttgtttgc tcctcactag ccgagagaaa ccgccagagg tggccgaatt agaaggcttg       840
     gacttagccg ttcgctcctt ttccctgcga ggttcctctg aagtcgccac tgcattactc       900
     aatgccaaag gaattgaggg tagccccgag cagcaacagc agctgagcca tcactatggg       960
     gggagtcctc tagccctcaa aattattgcc agctctatcc aagatttatt tgaaggcaac      1020
     ctagaggact ttttagccca agaaacggtg gcctttaacg gcatacgccg tctgctagac      1080
     cagcagttta aacggttgag tcccctcgaa aaagttattc tgaactggtt agcgattaat      1140
     cgagagtgga cttcgattgc agaattgcag cgagatattg tgccaaccgt atccatggcc      1200
     agcttactgg aatcgctgga agcccttacc tggaggaacc tgattgagaa aaatgtcagt      1260
     cgccaagggc aatctggaca atacaccttg caacctgtcg ttatggaata tgtgaccaat      1320
     gatttagtcc agcaggtgta tcaagatttg atggaagata cagactctca gggggtgcag      1380
     aggcaaggtc tgacatcatc acagtcctac tttcataccc atgctctact gaaaacaact      1440
     gtcaaagact atattcaaga cagccagaaa cgcctgatat tagagccctt agcccaatta      1500
     ctccgcaaca cttttttctc tgcccccatg ctggcgcaat gggtacagtc agtgttaaat      1560
     caactccata ccagtccagt gactggatat gggcctggaa atttgatcaa tctctgccgt      1620
     caactcaagc tggatttaac agggtatgat ttctcccaac ttcccatctg gcaggcaaac      1680
     cttcgggata tgtctttacc tcaggtcaat tttaaggggg ctaattttca gcagaccttg      1740
     ttcactcaat ctcttagcgg cattcttaac attgcctaca gccctaaagg agactttcta      1800
     gcaaccattg atgccactgg gagtgttcgc ctctggcaag ttgcggatgg tcaactccat      1860
     atgtcttttg aggatcacag ttactggggg tgggcattgg cctttagccc cgatggccag      1920
     caactggcca gtggcggcga agacaatatg gtcagagttt gggatgttac tactggccaa      1980
     tgtattaaca gtttggaact caagtgtaat gtggtttgga ctgtagcctt tagtcccaat      2040
     ggtcaaaccc tagcgattgg taccagtgat acggatattt tgctgtggga ccttgaaagg      2100
     aatcagttgc ccgaagtatt gcaagggcat accagcgatg tgagatcgct ccagttcagt      2160
     cctgatggtc aacagttagt cagtgctagt cacgatcaca cccttaaaat ttggaatttg      2220
     caatcaggaa agtgccagca aacttgtgtc ggccattctg agtgggtcct ttctgtcgct      2280
     tatagtattg atggtcagac cctagcgagc ggaagtgctg accgtacagt cagattgtgg      2340
     gatgtgaaga cggggcaatg ccgccagact ttatcggggc atgatcttat ggttactgcc      2400
     attgccttca gcccagatgg ccaacatatt gctagtgcca gtgaagaccg caccgtcaga      2460
     gtgtgggatg tccgtggcca gcatctgaaa accttagttg gtcatctgca ttgggtttgg      2520
     tccgtggcct ttagtccgga tggtcaaatg ctagccagcg gcgggagcga tcaaaccgtt      2580
     agattttggc acgtacaaac cggtcgacct ttgaagacct tggctggtta tatcgactac      2640
     tcctatgctc tagcctggct tcctgatgga caagctctac tatctggaag ctccaatcac      2700
     acgatacgca cttgggaaca aggtcgctgc agacaaacct ggaaggctca cgaaaactgg      2760
     gtttggtctg ttagctgtag acctgacgga caagttttag ccagtgggtc caacgctgtc      2820
     aaattatggg atatggagac caatgcttgt atagccacat tgcaggagga tgagggattt      2880
     gtcttttgtc tggcctggag tcccaatggc cgatattttg ctacaggttc ctcagatcat      2940
     cgagttagga tttggaaagc ggacactcag cgatgtctac aacttttgga agggcatgaa      3000
     ggttgggtgt ttcaggttgc ctggagtccc aatggtcaaa gtttggcgag ctgtggtgta      3060
     gatggaacag caaacgtctg gaacataaaa acaggagact gtctgcaaac gtttcatgaa      3120
     gacaattgga tttggtctgt ggtctggagt cctgatcacc gatttctggc ctacagtaca      3180
     gccgatggga acattaaatt ctgggacacc aaaacgtgga aactactgca gactctgacg      3240
     ggccatacgg ctcaagtcac ccggatcgac tttagtccct ctggcaggcg actagccagt      3300
     ggaagttacg accttacgat caaaatttgg gatgttgaga caggcaactg tcaacagact      3360
     ttaacggggc atactcaaat tattaccaat ctcgtcttta atcctgttga aacggacaat      3420
     agctgcctgt tggccagtgc gagtgaggat gaaaccctaa ggatttggaa tatcctttca      3480
     ggtgaatgtc agcatgttct tagaccagaa ggcccctatg aaggaatgaa cgttgctgac      3540
     acttcagggt taaccccagc tcaaatcaag tctctacaat ctttgggtgc tgtgacgggt      3600
     taa                                                                    3603
//

If you have problems or comments...

PBIL Back to PBIL home page