(data stored in ACNUC8465 zone)

EMBL: CP000828.PE164

CP000828.PE164       Location/Qualifiers
FT   CDS_pept        complement(170141..170566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0169"
FT                   /product="Biopolymer transport protein ExbD/TolR, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25255"
FT                   /db_xref="GOA:B0C7J5"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7J5"
FT                   /protein_id="ABW25255.1"
FT                   /translation="MRFRSRKTGSQIPEVNLVPLMDVLMSVLTFFIIISMTLTGQQVLQ
FT                   VTLPTSNTASIDNNKLPQQANPLVVGLTLKEEIILDNEPVNSGKLANRISTYIDKNPQG
FT                   RIILSADRKLPYSKVSALLKKMGKMGGDRISLLLQDK"
     atgcgttttc gatctcgcaa aactggttct caaatcccag aggtgaattt ggtgcctttg        60
     atggatgtat taatgtctgt gctgacgttt tttatcatca tttccatgac cttaacgggg       120
     caacaggttt tgcaagtgac cttgccaact tcaaatactg cctcaataga taataataag       180
     ctgccgcagc aggccaatcc gctggttgta gggctgacat tgaaggagga aatcatttta       240
     gataatgagc ctgtcaattc tggcaaactt gcaaatcgta tctctactta tattgacaaa       300
     aacccgcaag gaagaatcat tttgagtgcc gaccggaaac taccctactc aaaggtttct       360
     gcactgctca aaaaaatggg aaaaatgggg ggcgatcgta tatcacttct cctgcaggac       420
     aaatag                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page