(data stored in ACNUC5340 zone)

EMBL: CP000828.PE165

CP000828.PE165       Location/Qualifiers
FT   CDS_pept        complement(170571..170981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0170"
FT                   /product="biopolymer transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25256"
FT                   /db_xref="GOA:B0C7J6"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7J6"
FT                   /protein_id="ABW25256.1"
FT                   /translation="MKFAQQESTIPEINLIPMLNVMMGILAFFVMITMTLSKQKSLEVQ
FT                   LPQEAGGQQEIKLSDLKNQFVVDLDNQGQASRDKQSISDKELQAKVRQYLLDNPKGNVF
FT                   LKPNPKLTYEKMMHKLDLMRAAGGERVSLIIE"
     atgaaatttg ctcaacaaga atcgacgatt cccgaaatta acttgattcc catgctcaac        60
     gtgatgatgg gaatcttggc tttttttgtg atgatcacca tgaccttgag caagcaaaaa       120
     agcttagagg ttcaacttcc tcaagaagca ggtgggcaac aggagatcaa actctcggat       180
     cttaaaaatc aatttgtggt ggatctagat aaccaaggtc aggcatcccg ggacaagcag       240
     tccatctctg ataaagagct acaggccaag gtccgccagt atttgctgga taatcccaag       300
     ggcaatgtgt ttttgaagcc aaaccccaaa ttgacttacg aaaagatgat gcacaaactc       360
     gatctgatgc gagctgccgg gggtgagcgc gtgtctttaa ttattgaata a                411
//

If you have problems or comments...

PBIL Back to PBIL home page