(data stored in ACNUC27125 zone)

EMBL: CP000828.PE168

CP000828.PE168       Location/Qualifiers
FT   CDS_pept        176196..178244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0173"
FT                   /product="type I secretion target repeat protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25259"
FT                   /db_xref="GOA:B0C7J9"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7J9"
FT                   /protein_id="ABW25259.1"
FT                   /translation="MALFEGTGDISSVVADFQAALGGPNNGNTFGPVANGRREINWDAN
FT                   IVPFDMPADFFNKTVTRGAEFVTNAGSEFRVSNPDPSDPGAPDDEFDSINATYPDQFDT
FT                   FSEFRLFTPSGSNVTEVEFFVPGSDVRATSSGFGAVFTDVDLADSTKIEYFDIDGNLLQ
FT                   SEFVNPDPQGLSFLGATFEEGNLYKVKITSGNTPIGANDDPANGVDVVVIDDLLYGEPQ
FT                   AAETLDGDDGDNVLTGTPGGEFIRGFGGNDAILAFGGNDIAQGGDGNDVISGGDGSDFL
FT                   DGGAGDDTVIGDKGDDTKLGGDGNDRIIWNDGDGSDRIDGGADMDTVEVNGSPDLGDEF
FT                   EVAAGASDVFFQRVNLGQFDLDISTVETLEVNSDGGDDQFTVGDLSGTGLEKVVFNAGY
FT                   GSDVLEGADATTDVQALGGTGDDTFTSGSGNDTLEGEGGNDSLAGGNGDDQLLGGEGDD
FT                   TLRGGNGNDLTDGGSGNDTADFSDIPFEIRADLNTGKAQYDVAPGVTVEDTLVSIENLT
FT                   GSTFNDRLAGDRNANILDGGDGNDRLTGRRGADTLLGGNGDDNLIGGRGADRLVGGADK
FT                   DVLLGGRGADDLNGGTGNDLMRGGRGADVFRFERDLLDGIADRDVILDFQAQDAFNFDD
FT                   YLGAGGSVTISRITGGLNIDLSGEDTIMVFGSRSALNAAEAQLEALV"
     atggctttat ttgaaggaac aggcgatatt tcatctgtgg tagccgattt tcaggcagca        60
     ttaggtgggc cgaacaacgg caatacgttt ggcccagttg ccaacggcag acgagaaatt       120
     aattgggatg ccaatattgt cccttttgac atgcctgctg attttttcaa caaaaccgtt       180
     acccggggtg cagagtttgt gaccaacgcc ggatctgagt tccgagtaag caacccagac       240
     ccgagtgatc caggtgcccc agatgatgaa tttgacagta ttaatgccac ctacccagat       300
     cagtttgata cctttagtga atttcgactg tttacccctt cggggtcaaa tgtgacagaa       360
     gtggaatttt ttgtgcccgg ctctgatgtt cgagcaacgt caagcgggtt tggggcggtc       420
     tttacggatg ttgacttagc tgacagcacc aagattgagt actttgatat cgatggcaat       480
     cttctccagt ctgagtttgt taatcctgac cctcaagggt tgtcattctt gggggcaacc       540
     tttgaagaag gcaatttata caaagtcaaa attaccagcg gcaatactcc cattggagcc       600
     aatgatgatc ctgccaatgg ggtagatgtg gttgtcattg atgacttgct ctacggggag       660
     ccccaagcag ccgaaacgct ggatggtgat gacggtgaca acgtccttac cgggacacct       720
     gggggagagt ttattcgagg tttcggaggg aacgatgcca ttctggcctt tggcggcaat       780
     gacattgccc aaggaggcga tggaaatgac gttattagcg gtggagatgg cagcgacttc       840
     ctagatgggg gcgctggaga tgacaccgtt atcggtgaca aaggggatga caccaaactc       900
     gggggcgatg gtaacgatcg gattatttgg aatgatggtg atggatctga tcggattgat       960
     ggcggcgcag atatggacac cgtcgaagtc aatggcagcc ctgatttagg cgatgagttt      1020
     gaagtggccg ctggagccag cgatgtgttt tttcaacggg tcaatctggg tcaattcgac      1080
     ttggatatta gtaccgttga gaccctagaa gtgaatagtg atggtggaga cgaccaattc      1140
     accgttggag atctgtctgg cactgggcta gaaaaagtgg ttttcaatgc cgggtatggt      1200
     agcgatgtcc tggaaggtgc ggacgcgacc actgatgtac aagcattggg cggcactggc      1260
     gacgatacct tcaccagtgg ttcggggaat gacaccctgg aaggagaagg tggcaatgac      1320
     tctcttgctg gcggcaatgg tgatgatcag ctcttgggtg gtgaagggga tgacaccctt      1380
     cgaggtggca atggcaacga tctcacagac ggtggcagtg ggaacgatac ggctgatttt      1440
     agtgatattc cctttgagat cagagcggat ttaaatacgg gaaaagctca atacgatgtg      1500
     gccccaggtg taaccgtcga agacacatta gtcagcattg aaaacttgac gggtagcact      1560
     tttaatgacc gactagcagg agatcgcaat gccaatattt tggatggtgg agatggcaat      1620
     gatcgcttaa cgggtcgtcg aggagccgat acgcttctag gaggcaacgg agatgacaac      1680
     ttaatcggtg gtagaggagc cgataggcta gttggtggcg cggataaaga tgtcttgctg      1740
     ggcggtcgag gagctgatga cctcaatggt ggaaccggca acgatctgat gcgaggcggt      1800
     cgaggggctg atgtctttcg gtttgaacgt gatctcctag acggcatcgc tgatcgtgat      1860
     gttattctgg atttccaagc ccaggatgcc ttcaatttcg atgattacct gggtgctggc      1920
     ggatccgtta ccatctcaag aattacgggc ggcttaaata ttgatttgag cggagaggat      1980
     accattatgg tttttggtag ccgaagtgcc cttaatgcgg cagaagccca actggaagca      2040
     ttggtctaa                                                              2049
//

If you have problems or comments...

PBIL Back to PBIL home page