(data stored in ACNUC8465 zone)

EMBL: CP000828.PE173

CP000828.PE173       Location/Qualifiers
FT   CDS_pept        182531..182800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0178"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25264"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7K4"
FT                   /protein_id="ABW25264.1"
FT                   /translation="MNSPHSPKDQSDSKYRYLYPRSKYRGSFTPEKLAFNANLQEFAHK
FT                   VTFICALETSGKISSLQAYKDIKRLWKQLKKSKNNLQIGQDQLD"
     ttgaattcac cccattctcc taaagaccag tccgatagca aatatcggta tttataccct        60
     cgtagtaaat acagagggag ctttactcct gaaaaacttg cattcaatgc aaatcttcag       120
     gaatttgccc ataaagttac ttttatctgt gctctagaaa catcaggaaa aatctcttct       180
     ctgcaggctt ataaagacat caagcgcctt tggaaacaac ttaaaaaaag taagaacaac       240
     ttacagatcg gtcaagatca actggattaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page