(data stored in ACNUC5340 zone)

EMBL: CP000828.PE174

CP000828.PE174       Location/Qualifiers
FT   CDS_pept        183257..184285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0179"
FT                   /product="CHAD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25265"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7K5"
FT                   /protein_id="ABW25265.1"
FT                   /translation="MKTQSSSSTQKRKTKALQLDAQLSLGEVAYRGIQKHFKKSTKYQD
FT                   GVLADRDPENLHQMRVGMRRLRTALEVFGPAIDLPEAAQSSQVTKIAKQLGKVRDLDVL
FT                   QLWFQHFLSISSTSAEEAQEIKRVLGRLNKRRQKKFAQLPKLFKSKLYRQFVAAYQDWL
FT                   EKPQYQAIAMMPVLDVVPDLLLPLLSQLFLHPGWLVATEPLEGRIYPMVGMSMEALDQV
FT                   LAQEGPDLHDLRKQMKRVRYQTEFFVPFFGKTYQTQTRGFRDLQELLGLFQDEAVLSEF
FT                   LVKELGASWPDQLPSLAKLLQEERFRNWKKWQAQQLKYLDPKFRRTLSRRVMSPSLETL
FT                   TT"
     atgaaaactc aatcctcatc ttctactcaa aagagaaaaa cgaaggcttt acagctcgat        60
     gcccaattat ccttggggga agtggcctat cgagggattc aaaaacattt taagaaatct       120
     actaagtatc aagatggggt actggcggat cgcgatccag aaaatctaca ccaaatgcga       180
     gtgggcatga gacgattgag aactgccctt gaagtatttg gtcctgcgat tgatctaccc       240
     gaggctgctc aatcctctca ggttactaaa attgccaagc agttaggcaa ggtgcgagat       300
     ttagatgtct tgcaactctg gtttcaacat tttttatcca tttccagtac gagcgctgaa       360
     gaagcccagg aaattaagcg ggttttaggc cgactaaaca aacgccgtca gaaaaagttc       420
     gctcaactcc ccaaattgtt taagagcaaa ctctatcgac aatttgtcgc cgcataccaa       480
     gattggctag aaaagccaca ataccaggct attgccatga tgcctgtatt agatgtggtc       540
     ccagatttat tattgcctct gctcagccaa ctctttcttc atcctgggtg gctagtggca       600
     acggaacccc ttgaagggcg catctatcct atggtgggca tgagtatgga agctctggat       660
     caggtgttgg ctcaagaagg acccgatctg catgatttgc gtaagcaaat gaaacgagtg       720
     cgctatcaaa cagagttctt tgttccattt ttcggaaaaa cctatcagac tcagacgcgg       780
     ggctttagag atctgcaaga attattggga cttttccaag atgaggcagt cttaagtgaa       840
     ttcttggtca aagaattggg agcctcttgg ccagatcagc ttccttcctt agccaagcta       900
     ctgcaagaag agcggtttcg aaactggaaa aaatggcaag cgcaacagct caagtatttg       960
     gatccaaagt tccgacgaac cctcagccgt cgagttatgt caccatcctt ggaaacactg      1020
     acgacctga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page