(data stored in ACNUC5340 zone)

EMBL: CP000828.PE175

CP000828.PE175       Location/Qualifiers
FT   CDS_pept        complement(184336..184878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25266"
FT                   /db_xref="GOA:B0C7K6"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7K6"
FT                   /protein_id="ABW25266.1"
FT                   /translation="MSQTLTLPSPTAPTLQSTFPQTETYFITLCTHERECLFGEIIAGE
FT                   MQLNDLGALVAEEWQISFDQSSDFDLHHWVMMPNHIHGIIGAANPSSQDLAQQPLMQET
FT                   KVRSHSLLKWISSFKGMASQRIKHLRNLPHQPLWQQEVDQHIIPHRFAFHTFHQYITTN
FT                   PHAWDWDKLHPDSPALS"
     gtgtctcaaa ctttaaccct cccttccccc acagccccca ccctccaatc gacatttcct        60
     cagacagaga cctactttat tactctctgc acccatgaac gagagtgctt gtttggggaa       120
     attattgctg gtgaaatgca gcttaatgat ttaggagcat tagttgcaga agaatggcag       180
     atctcattcg atcagagttc cgactttgac ctccaccatt gggtgatgat gcctaaccat       240
     attcacggca ttattggcgc agctaaccca agctcccaag acctggccca acagcccctg       300
     atgcaggaaa cgaaggtgcg atcgcattcc ctgctcaagt ggatctcatc ctttaaaggg       360
     atggccagcc aacgcatcaa gcatctgaga aacttgcccc atcaacccct ttggcaacaa       420
     gaagtggatc agcacatcat tcctcatcgg tttgcctttc acactttcca ccaatacatc       480
     actaccaacc cccatgcctg ggattgggat aaattacatc cagatagtcc agctctatcc       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page