(data stored in ACNUC27125 zone)

EMBL: CP000828.PE176

CP000828.PE176       Location/Qualifiers
FT   CDS_pept        185901..186023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25267"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7K7"
FT                   /protein_id="ABW25267.1"
FT                   /translation="MIGTPQHLVSAAQYDIDFIESHTFHSSEMPQEIRTPFLFS"
     gtgataggta caccacagca tcttgtcagt gcagcccagt acgatattga ttttattgag        60
     tcccacacat ttcattcatc agaaatgccc caggagatta gaacgccatt tctattttct       120
     taa                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page