(data stored in ACNUC27125 zone)

EMBL: CP000828.PE178

CP000828.PE178       Location/Qualifiers
FT   CDS_pept        187124..187498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0183"
FT                   /product="STAS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25269"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7K9"
FT                   /protein_id="ABW25269.1"
FT                   /translation="MQQLPSFCIVHPPQHLTSTTQDVFYQHIYELVQSRVEVILINLET
FT                   VTRLDSGGLGILFGAFRISHRQGKRLMLYSPQSHVVQNLHKTGLTQIVGTYATLADCIK
FT                   DAIPYSHRWVQDLSIQLPEF"
     gtgcaacaac taccgagctt ctgtattgtt caccctcctc aacatctcac ttccacaacc        60
     caagacgtgt tttatcaaca tatctatgag ctggttcaat ctcgggttga ggtcattcta       120
     atcaatttgg aaaccgtcac ccgtcttgat agcgggggtt taggtatttt atttggcgct       180
     tttcggattt cccatcgtca aggaaagcgg ttaatgttgt attcgcctca atcccatgtg       240
     gttcagaatc tccacaagac aggactgacc caaatcgtgg ggacttatgc aaccctagca       300
     gactgcatca aagatgctat tccctactcc catcgctggg ttcaagatct atcgattcaa       360
     ctgcctgagt tttaa                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page