(data stored in ACNUC5340 zone)

EMBL: CP000828.PE18

CP000828.PE18        Location/Qualifiers
FT   CDS_pept        complement(20343..21668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0020"
FT                   /product="PhoH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25109"
FT                   /db_xref="GOA:B0C4Z7"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B0C4Z7"
FT                   /protein_id="ABW25109.1"
FT                   /translation="MKKAFVLDTNVLLHDPNAIFRFEDNDVVLPITIIEELDRFKKQPQ
FT                   ETGRNARQVSRTLDDLRAQGQLTKGIELPKGGTIRVALCDRITLNELPPELEGDQADNA
FT                   ILAVALELKNQCQCPVALVSKDTNLRIKADVLGLAAEDYSTDKVDFEGLYTGMTSVMVG
FT                   SDTISQLFQSGQTTLAEKTWPNQAVTLVDSLKPSHTALALAGDHTGEVMPLPKFPHNGI
FT                   SRIRARNREQKFAFELLMRDDIALVTLVGKAGTGKTLIAIAAGLHKVADEKNYSRLLIA
FT                   RPVVPMGRDLGYLPGDIDEKLTPWMQPLYDNFDLIFGTQEAAGQPQHWRRGHEELMDQG
FT                   LLQIEPLTYIRGRTIPKQFLIVDEAQNLTPHEVKTILTRAGEDTKVVLTGDPEQIDNPY
FT                   VDAASNGLTYVVERFKSESIAGHITLYQGERSDLAERAAALL"
     atgaaaaaag cgtttgtcct tgatacgaat gtactgctgc atgatccaaa tgccatcttt        60
     cgctttgagg ataacgacgt agtcttgccg attacgatta tcgaagaact cgatcggttc       120
     aaaaagcagc cccaagagac cgggcggaat gcccgtcagg tgtcgcgaac cttggatgat       180
     ctgagggcgc aggggcagct gacaaaaggg attgaactgc caaagggtgg aacaatacgg       240
     gttgctttgt gcgatcgcat cacccttaac gagcttcccc cagaactaga aggggaccaa       300
     gccgataacg caattctggc cgtggccttg gaactgaaaa atcagtgcca atgtcccgtg       360
     gctttagtga gcaaagatac caatctccgc attaaagcgg atgtattggg attggctgca       420
     gaggattact ccacggataa agttgatttt gaagggctct atactggcat gacttcagtc       480
     atggtaggga gcgatacgat tagtcaactc ttccaatcgg gacagaccac cctggccgaa       540
     aaaacatggc ccaatcaggc ggttacttta gtggatagcc tcaagccttc ccatacagcc       600
     ttagctttag ctggagatca tacgggcgaa gtcatgccgt tgcccaaatt tccccataac       660
     ggcatttcta gaattcgggc gcggaatcgc gaacaaaaat tcgcctttga attactcatg       720
     cgagacgata ttgctttagt caccttggtc gggaaagcgg gaaccggcaa aacgttgatt       780
     gcgatcgcag caggattaca taaagttgcg gatgagaaga actacagtcg tttgttaata       840
     gcccgtcctg tggttcccat gggacgagat ttggggtatt taccgggaga tattgacgaa       900
     aaactcaccc cttggatgca gcccctctat gacaattttg atctgatttt tgggactcaa       960
     gaagcggcag ggcaacctca gcattggcgg cggggacatg aagagttaat ggaccaaggg      1020
     ctcctccaaa tagaacccct cacctatatt cgcggacgga ccattcccaa acaatttttg      1080
     attgtggatg aagcccaaaa ccttactccc catgaagtta agaccattct gactcgtgct      1140
     ggggaagata ccaaagtggt gctcactgga gaccctgagc aaatcgataa cccctatgtg      1200
     gatgcggcca gtaatgggtt gacttatgta gtagagcgat ttaaatctga gtccattgcc      1260
     ggccatatca ccctatacca aggtgaacgg tcagatttag ctgaaagagc agccgcttta      1320
     ctgtag                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page