(data stored in ACNUC5340 zone)

EMBL: CP000828.PE180

CP000828.PE180       Location/Qualifiers
FT   CDS_pept        complement(188564..188839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25271"
FT                   /db_xref="GOA:B0C7L1"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7L1"
FT                   /protein_id="ABW25271.1"
FT                   /translation="MNTITHPPSIPSNSSGKSIFSSKTFWGIIFTTVAAIAPIVGNSVD
FT                   EGKMTGKDISQIVVILCGTGATLVGRIEAGNVYTPDMMPGPNKTDM"
     atgaatacca tcactcatcc cccttccatt ccatccaaca gctcaggtaa aagtattttt        60
     tccagtaaga ccttctgggg aattatcttt acgaccgttg ctgccattgc ccccatcgtt       120
     ggcaacagtg tagatgaggg taaaatgacc ggcaaggata tctcccaaat tgtagtgatt       180
     ctctgcggca caggcgcaac attagtggga cgcattgaag ctgggaatgt ctatacaccg       240
     gacatgatgc caggccccaa caagacggat atgtag                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page