(data stored in ACNUC27125 zone)

EMBL: CP000828.PE181

CP000828.PE181       Location/Qualifiers
FT   CDS_pept        complement(189139..189624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25272"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7L2"
FT                   /protein_id="ABW25272.1"
FT                   /translation="MANLFLYSTLVALQSSVLLPSPALSSNVLLAKKDKKPPAAVVTEV
FT                   EILKENFADTWFYTLRGSLKNQSDASILTPLVYYEIYSEETDKIIEAGTAEITPKILTA
FT                   GTTGRFQNELNTTGKIRITLVQWQQVDKAIKSHKQMQFFPLETEGATEEEAGNPSSP"
     atggccaacc tctttctcta ttcaaccctt gtcgcattgc aaagcagcgt cctcctgccc        60
     agtccggctc tatcttctaa tgttttactc gctaaaaagg acaaaaagcc acccgccgca       120
     gtggttacag aagtagaaat tttgaaagag aactttgctg acacctggtt ctatacgtta       180
     cggggcagtt taaaaaatca gtcagatgct tcaattctga cccccctggt ctattacgaa       240
     atttattctg aagagacgga caaaattatt gaagcaggca cagccgaaat tacccccaag       300
     atcttgaccg ctggcacaac tggccgcttc caaaatgagc tcaataccac tggcaaaatc       360
     agaattacgt tagtgcagtg gcaacaagtt gataaagcca ttaaatccca taagcagatg       420
     cagttctttc ccttagaaac tgagggggcg acagaggaag aagcaggcaa tccatcttcc       480
     ccctaa                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page