(data stored in ACNUC5340 zone)

EMBL: CP000828.PE186

CP000828.PE186       Location/Qualifiers
FT   CDS_pept        complement(191849..192307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25277"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7L7"
FT                   /protein_id="ABW25277.1"
FT                   /translation="MTSTAVTARPCLATVAASDANNVWIAYNGPEFLGRIYKDFSGNFY
FT                   YELGRSISQRFGSKQDALFSLYETTERANQQHQKQISSELESITENWGHVAVPGSANAR
FT                   RIPNVGCKRPKVLTHAKPSTQTKPSHTQTVIIGRTECVKTKHGLIAID"
     atgacatcaa cagcagtcac cgcccgccct tgtctcgcca ctgttgccgc ttctgacgct        60
     aacaatgttt ggatcgccta taacggccca gagtttttgg gtcggatcta caaagatttt       120
     tctggtaatt tctactacga gttgggccgt tcaatctctc agcgcttcgg gtccaagcaa       180
     gatgcgctgt tcagtctcta cgaaacaact gagcgcgcca accagcagca ccaaaagcaa       240
     atctcttctg aactggagtc aatcactgaa aattggggcc acgttgcggt gcctggatct       300
     gctaacgccc gtcgcatccc taacgtcggc tgcaagcgcc ccaaggtcct cacacacgcc       360
     aagcccagca cccaaaccaa gcccagccac acacagaccg taatcatcgg tcgtaccgaa       420
     tgcgtcaaga caaagcacgg tttgatcgcc atcgactaa                              459
//

If you have problems or comments...

PBIL Back to PBIL home page