(data stored in ACNUC8465 zone)

EMBL: CP000828.PE189

CP000828.PE189       Location/Qualifiers
FT   CDS_pept        complement(193837..194169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25280"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7M0"
FT                   /protein_id="ABW25280.1"
FT                   /translation="MVDGKILAEEEERLNYIATQLDLKLIEDYLGVSDELLADYDIDPD
FT                   TVPDANQWFDISEGIQWFDSLISYIQENPDIVNDKDSLHAELQDFRKVLQEAKNSTTRW
FT                   HLAMDI"
     atggttgatg gcaaaattct agcagaagag gaggaaaggc taaattatat tgctactcaa        60
     ctagacttaa agttaattga agactattta ggcgtcagtg atgaattact ggcagattat       120
     gatattgatc ctgatacggt acccgatgct aatcaatggt ttgatatatc tgagggaatt       180
     cagtggtttg atagtttgat atcttacatt caggaaaacc cagacatagt aaatgataaa       240
     gactcattgc atgcagagtt acaagatttt cgaaaagtat tgcaagaagc caagaattca       300
     acaacaagat ggcatttggc aatggatatc taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page