(data stored in ACNUC5340 zone)

EMBL: CP000828.PE19

CP000828.PE19        Location/Qualifiers
FT   CDS_pept        complement(21929..22390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B0C4Z8"
FT                   /protein_id="ABW25110.1"
FT                   /translation="MKSKVLMPLLLLAVLGVPVRVMAHALETNYVLEEVNKVQFTAVFS
FT                   TGEPHKKAKVKIYSPDNLTEPVMETETDENGQFTFDTSEKMPGEWEVSIGESGHQDILT
FT                   VPVTPKGININEISEVPQHQSPQIPLVAIVLSGGMGSAAVLSRKLRSIK"
     atgaaatcta aagtattaat gccgcttctg ttgttggctg tactgggagt tcctgttcgt        60
     gtgatggccc atgccctgga gacgaactat gtcttagaag aagtgaataa ggttcagttt       120
     acggctgtat ttagtacagg tgaaccccat aaaaaggcca aagtcaaaat ctattcccct       180
     gacaatttga ctgagccagt gatggagacc gaaacggatg aaaatggcca gtttaccttt       240
     gataccagcg aaaaaatgcc gggagaatgg gaagttagca ttggcgaatc gggtcatcaa       300
     gatattttga cggtgccagt gaccccgaag ggaatcaata taaacgagat tagcgaagtc       360
     cctcagcacc agtctcctca aattcccctt gtggcaatag ttctctctgg cgggatggga       420
     tcggcggctg tgctatctcg caaactcagg tcaatcaagt aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page