(data stored in ACNUC5340 zone)

EMBL: CP000828.PE191

CP000828.PE191       Location/Qualifiers
FT   CDS_pept        194978..196156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25282"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7M2"
FT                   /protein_id="ABW25282.1"
FT                   /translation="MQISKGANYLWGLLVITLLVVVSASHLATKNMSHPHPKQRYFYQG
FT                   FIYQPYDWSDEAFEETFRVIGENSDIIGFYFDGFVPWNEAAAKKTYHPVQEQEIQKRIN
FT                   GIKPHQKIFLGTSLLGSDRVSLSGYLGEYEVPRTGKWKDKTFDDPEVIAAYLHWCRDLI
FT                   TRFQPDYFMYVAEVDSGLVNVDDPRFQSLLRSVKQIYPVLKREFPSLPILIEFVLENDE
FT                   QMSKRSEVTQSLLPYTDMYAVSTFPFIMTGGNPADIPKDWFSRAKEIAPNKPFAVVETN
FT                   FLAEDFYHPTQGIPIPFRKKRLLIPAREKWQAAYIEFLLSEAHRLEAEFVLHWGYRDLD
FT                   QLQAKLDGTGGAFDSNIHGFASLSKDCGLIDEKGRPRPSFNVWQRWLSLPKV"
     atgcagatat ccaagggagc caactatctt tggggactgc tagtaatcac ccttttagtc        60
     gtggtatcag ccagtcatct tgcaactaag aatatgagcc accctcatcc aaaacaacgt       120
     tatttttatc aaggttttat ctatcagcct tatgactgga gcgatgaagc ttttgaagaa       180
     acttttcggg tgatcgggga aaacagtgac atcattggtt tctactttga tggttttgtg       240
     ccctggaatg aggcagcagc aaagaaaacc tatcatccag tacaggagca ggaaatccaa       300
     aaaagaatca atggcattaa acctcaccaa aagattttcc tggggacgag tcttttaggg       360
     agtgatcggg tcagtctctc gggttattta ggggaatacg aagttccaag aacaggcaag       420
     tggaaagata agactttcga tgatccagaa gtgattgcgg cttatcttca ttggtgtcga       480
     gatctcatta cccggtttca gcctgattat tttatgtatg tagcagaggt agattctggc       540
     cttgttaacg ttgatgatcc tcgcttccaa agtctactcc gttcggtgaa gcagatttac       600
     ccagtattaa aacgggagtt cccatccctg ccgatactca ttgaatttgt gctagaaaat       660
     gacgaacaga tgagtaaacg atcggaggtg actcaatcgt tattacccta tacggatatg       720
     tatgcggtga gtaccttccc cttcattatg acgggaggca atcctgcgga tattcctaag       780
     gattggtttt cacgggcaaa ggaaatcgca ccaaataagc cgttcgcagt cgttgaaact       840
     aatttcttgg ctgaagactt ttatcatcca acacagggaa ttcctattcc atttaggaag       900
     aaacgcttac tgattccggc gcgagagaag tggcaagctg cgtatattga attcttgctt       960
     tctgaagccc atcgattgga ggcagagttt gtgttgcact gggggtatcg cgatttggac      1020
     caattgcaag ccaagttgga tggtacgggt ggtgcgtttg attcaaatat tcatggcttt      1080
     gccagtttat ctaaagactg tggacttatt gacgagaaag gtcgtcctcg cccctccttt      1140
     aacgtatggc aaagatggct gtctcttcca aaagtctag                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page