(data stored in ACNUC27125 zone)

EMBL: CP000828.PE193

CP000828.PE193       Location/Qualifiers
FT   CDS_pept        199516..199923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0198"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25284"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7M4"
FT                   /protein_id="ABW25284.1"
FT                   /translation="MLKHVLMIVSKFANGITATSEGISAAELIHPYDVFRMANCKVTIA
FT                   SSRGGAVVFKPLRDPSDLSGASNLDPLSARYIAQPRFIKRLMNTPAISELNISDYDAIF
FT                   VCGGEGTLYTKASGLSYTKASGLGIQDHFLQ"
     atgttaaagc acgtgttaat gatcgtttct aagtttgcca atggtataac ggctacatcc        60
     gaagggatct cggctgccga gctaattcat ccttatgatg tgtttagaat ggcaaattgt       120
     aaggtgacga tcgctagctc aagaggaggg gcggtagttt ttaaacctct aagagacccc       180
     agtgatttgt ctggagcctc taatttagat cccctctcag cccgatatat tgctcagccg       240
     agatttataa agcggcttat gaacactccc gcaatctcag agcttaatat cagtgattat       300
     gatgcaatct ttgtttgtgg aggggaagga acactttata cgaaagcgtc aggactaagt       360
     tataccaaag catcgggact ggggattcaa gaccattttt tgcaataa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page