(data stored in ACNUC5340 zone)

EMBL: CP000828.PE194

CP000828.PE194       Location/Qualifiers
FT   CDS_pept        complement(199932..200834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0199"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25285"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7M5"
FT                   /protein_id="ABW25285.1"
FT                   /translation="MEQAQMIQAVNAMAQAMAKPTRTPVYRRPNEYGMVYEDIFFNAID
FT                   GTRLEGWFIPADSDRLIICNHFGPGNRYGFAGHLEEFSFRGGFEVNFLPAYQALHEAGY
FT                   NIIAYDIRDHGLSASSGANGFSQLEWRDIIGAVRYAKSRLETRDLKTSLHTMCLGCNST
FT                   LIAMAKHPEEFEHIISMTALQPVLGRAMIEKSCQSMGIDPIEGAELYDQQQRKIYGFRL
FT                   DDYNAMKQVSAIKIPTLVLQVRNDASMQAEAIQGFYDALPNPDKKIIWVEETAERFRGY
FT                   AYFSEHPEQLVAWFDAHMT"
     atggaacaag cacagatgat ccaagccgta aacgccatgg cccaagcgat ggcaaagcct        60
     actcggaccc ccgtctatcg acgcccgaat gagtatggca tggtgtatga ggacattttc       120
     tttaacgcca ttgacggcac tcggttagag ggatggttta tccccgcaga ctcggatcgc       180
     ttaatcattt gcaaccactt cgggccaggt aatcgctatg gctttgccgg tcacctggaa       240
     gaatttagct tccgtggcgg ctttgaagtg aacttcttgc ccgcctacca agctctgcat       300
     gaggctggct ataacatcat tgcctatgac attcgcgacc atggcttgag tgcatcttcg       360
     ggagccaacg gttttagtca gctagaatgg cgcgatatca ttggtgccgt gcggtacgcc       420
     aagagccgtc tagagactcg cgatttgaag acctctctgc atacgatgtg cctagggtgt       480
     aattccacct tgatcgccat ggccaagcat cccgaagagt ttgaacacat tatttccatg       540
     acagccctcc agcccgtctt gggtcgagcc atgattgaaa aatcttgcca gagcatgggc       600
     attgacccta tagagggcgc tgaactctat gaccaacagc aacggaaaat ctatggtttc       660
     cggctcgatg actataacgc tatgaagcag gtgtcagcca tcaagatccc aactttagtg       720
     ctgcaggtca gaaacgatgc gtcaatgcag gctgaggcta tccaaggatt ctatgatgcc       780
     ttgcccaacc cagacaaaaa aatcatttgg gtggaagaga ctgcagagcg ttttcgaggg       840
     tatgcctatt tttcagagca tcccgaacag cttgtggcat ggtttgatgc acacatgacc       900
     taa                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page