(data stored in ACNUC5340 zone)

EMBL: CP000828.PE197

CP000828.PE197       Location/Qualifiers
FT   CDS_pept        complement(202223..202357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25288"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7M8"
FT                   /protein_id="ABW25288.1"
FT                   /translation="MLTPVQHNKRLSGMEKEQMFQAVNAMAQAMAKPTQSPVYQRPNE"
     atgctaacac ccgttcaaca caacaagaga ctgagtggca tggaaaaaga acagatgttc        60
     caagccgtaa acgccatggc ccaagcgatg gcaaagccca ctcagtcccc cgtctatcaa       120
     cgcccgaatg agtag                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page