(data stored in ACNUC8465 zone)

EMBL: CP000828.PE198

CP000828.PE198       Location/Qualifiers
FT   CDS_pept        complement(202391..203266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0203"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25289"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7M9"
FT                   /protein_id="ABW25289.1"
FT                   /translation="MFGNMVSNMMVKPSQSPLFDSPTDYGLNYENVEFKARDGVTLRGW
FT                   LIKGGTDRVIVQSHFGVQCNRGGWSPKGRGPIAPWKEDIKFLRQAKYLAEQGYSVLMYD
FT                   LRGHGESDLGTIPWVSWGPEEAKDVVAAVDFVSARPEFANASVGLLSICMGAASTTYAY
FT                   GLADGLASRDKVKALVNVQPLLYSYFVKALGMPGFMERAGAKVSRDRLGFNMAEPNFIN
FT                   DAPKISVPTLVLQNQNDPWTNLDMVQSYYDALTVEKDLRMLDLEASRFAGYDYLGRSPE
FT                   AFVGWFDQYL"
     atgtttggca atatggtttc caatatgatg gtcaagccat cccagtcacc gttgtttgac        60
     agtcctacag actatggact caactacgaa aatgtggagt tcaaagcgcg tgacggtgta       120
     accctgcggg gctggttgat caaaggaggc acagaccgcg tgattgtgca gagccatttt       180
     ggtgtgcaat gcaaccgtgg tggctggtct cccaaaggca gagggccgat cgcaccctgg       240
     aaagaagaca tcaagttttt acgccaggcc aaataccttg ctgagcaggg ctattccgta       300
     ttgatgtatg acctgcgggg gcatggagaa agcgacctag gtacgattcc gtgggtgagc       360
     tgggggcctg aagaagctaa ggatgtcgtg gcagcagtag actttgtttc ggctcgacct       420
     gagtttgcca atgccagtgt ggggctgctt agtatctgca tgggggctgc ttccaccacc       480
     tatgcctacg gcttagcaga tgggttagcc agtcgtgaca aggtaaaggc gctggttaac       540
     gtgcagcccc tgctttacag ctacttcgtc aaagcactgg gcatgcctgg atttatggag       600
     cgcgccgggg ccaaggtctc tcgcgatcgc ctcggcttca atatggctga gcccaacttt       660
     atcaacgatg cccctaaaat ttcagtcccc acattggtcc ttcagaacca gaacgatccc       720
     tggaccaatc tggacatggt gcagtcctac tacgatgccc tgaccgtgga aaaagatctg       780
     cggatgctgg acttagaagc cagccggttt gcgggctacg actatctggg acggtctcca       840
     gaagcatttg tgggctggtt tgatcagtac ctctaa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page