(data stored in ACNUC8465 zone)

EMBL: CP000828.PE2

CP000828.PE2         Location/Qualifiers
FT   CDS_pept        2404..3255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25093"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B0C3W3"
FT                   /protein_id="ABW25093.1"
FT                   /translation="MQQHFEVAAGSILGQNHRRVSQNNQDAWASLTLGQATIAVVCDGC
FT                   GSRPKSEVGAQLGAQLTVHALAQLVAEEQPEDELFWQMLRKHLLGGMQTLQERLGADSQ
FT                   RLVDYWLFTLMGCLVTPETTWIFGLGDGVFAINEEFHQIGPFTNNAPPYLAYSLLWNTE
FT                   KGLDPFQLQIYAQHPTEQVQSVLIGSDGVGDLVNVAEDYLPGKSELVGPLNQFWCCDRY
FT                   FQNPDQVRRRLAQINREVIQPDWHTRQVRKIPGLLPDDTTLISIRRKGTKEGGSDARCN
FT                   CR"
     atgcaacagc attttgaagt cgcggccggg tctattttgg gccagaacca tcgacgagtg        60
     agtcagaata atcaagatgc ttgggcaagt ctgacgctag gtcaagcaac cattgcggtg       120
     gtatgcgatg ggtgcggaag tcgacctaaa agtgaagttg gcgcgcagct tggggctcag       180
     ttaacggtgc atgctcttgc ccaactcgta gcagaggagc aaccggaaga cgagctgttt       240
     tggcagatgt tgaggaagca cctattagga gggatgcaga ctttacagga gcggctagga       300
     gcagattcgc agaggctggt ggattactgg ttattcactc tgatggggtg tttagtgacc       360
     ccagaaacaa cctggatttt tggcctaggg gatggggtat ttgccatcaa tgaggagttc       420
     catcagattg gcccatttac taacaatgcc ccgccctatc tggcctacag cttgctatgg       480
     aacaccgaga agggcctcga tccgtttcaa ctccagattt atgctcaaca ccccacagaa       540
     caggtgcagt ctgtgctgat tgggagcgat ggagtggggg atttagttaa tgtagcagaa       600
     gattatctcc ctgggaagtc agagctggta ggaccactga atcagttttg gtgttgcgat       660
     cgctatttcc agaaccctga tcaggtgcga cgacggctcg ctcaaattaa tcgagaggta       720
     atacagccag attggcatac ccggcaggtg cggaagatac ccgggttatt accagacgac       780
     actacgttaa tcagtattag acgcaaaggg acaaaagaag gaggtagcga tgctaggtgc       840
     aattgcaggt ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page