(data stored in ACNUC8465 zone)

EMBL: CP000828.PE20

CP000828.PE20        Location/Qualifiers
FT   CDS_pept        complement(22537..25671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0022"
FT                   /product="WD-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25111"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B0C4Z9"
FT                   /protein_id="ABW25111.1"
FT                   /translation="MLTLDLGQLVYTSFPDQGFQTLSSADVPEEVKQVFLTQVVYKYWN
FT                   SYAPPQPGYRAAYLAQISPELTLFGWMYNQGDDDLGRSHIPYFIAYCLSGVLDNPLLDT
FT                   IYACLERGPVTFIERHRVSSDLHRVVIDQIDDLQPTLPGVMIPSGTRARCRLLLNKGKL
FT                   LNFSVAIPGESELANGKENDPQMPQETSADALVPDVDNQPLLSSLERLLESPRITLDSM
FT                   TRVPTTKNALLIGVSHCEHGFEPLPGVQQDIAVMKQVLENPKIAAFDEVQTLLNPNPQI
FT                   LAESLESFCQDRDIDDLLVVYFSGHGVVLDDHGRFGLTTSMSRTNSKGKVVRSTLVSAD
FT                   LLQDILNDSKAERQVVVLDCCYRQTDTSANNPHLGGVNLPQYLGGLGRTIMTSATQARH
FT                   AFVHKGADLSLYTFYLVEGLRTGAADQNCDGSISVEEWYAYGKRKVKQEIPAIEPQIYN
FT                   VKAVQNLALAQAAIDEPQFVYRRQFEFYAGRGEVSPVNRVILDNLQSSLDLDIEMAKII
FT                   EAEVSKPGKAYQTKLQEYAMAFVEAVRQEYPVSDYLQDQFRQFQATLGLTDADTIPVES
FT                   AIIRQVQVIQFPGQAPEPPRRAVPSTTWSNQTVIQPLHQALGVGQQTLKTSAQRLTSLG
FT                   QNLSMTVSQSVRNARYRVNLSSVSWRQVQSVPKRVWWFAGAGAIALLLLMSVLRQQQEA
FT                   QQRQKEAQQMEFWQSLAQQKRYDNCIAQTQNIPKDSRLYPSAQKLFSQCQAGINWKNAQ
FT                   LKTLSNAPKQAIWSVALSPDGKTLIGSGDQNDIKLWNLGKGQLIRTLSDHKDQVWTIAL
FT                   GPKGKILASASGDCTIKLWDVPTGKLLRTFAAHPMTVWSVAISPDGTLLVSGSEDRTLK
FT                   VWNIKTGKLVRTLKGHSGQVRSVAISSNGQMIASASSDKTVKLWELKTGKLLRTFKGHT
FT                   GRVISIAFGPSSQRLASASQDKTVKLWDLKSGKLNRTIQEHTKPVTAVTFSPDGNTLAT
FT                   GSLDRTVKLWNLSTGALRHTLTGYQGDIYSLAFAADGQSLVSSSKNSAIKVWSRD"
     atgctaacgc tagatcttgg tcaactggtt tacactagct tccctgatca gggctttcag        60
     actctcagta gtgctgatgt cccggaggaa gtgaagcaag tttttttaac ccaggtggtt       120
     tataaatatt ggaattctta tgcgccgcct cagccagggt atcgagcggc ttatcttgct       180
     caaatctctc ctgagttaac cttatttggc tggatgtata accaagggga tgatgattta       240
     ggccgaagtc acatccccta ctttattgcc tattgtttat caggggtcct ggataatccc       300
     ctcttggata caatctatgc ctgcttggag agaggtcctg tgacgtttat tgaacgtcat       360
     agggtttcgt ctgatctcca tagggtagtc attgaccaga tagatgattt gcagccgaca       420
     ttgcccggcg tgatgattcc gtctggtacc cgggcacgat gtcgtttgct actcaacaaa       480
     ggtaaactac tcaatttctc ggtggctatt cccggcgagt cggagttggc gaatggcaag       540
     gagaatgatc ctcaaatgcc gcaagaaaca tcagctgatg ccctcgtacc agacgtggat       600
     aatcagcccc ttttgtcttc tctagagcgt ttgctagagt ctccgagaat taccttagac       660
     tcgatgactc gggtacccac gactaagaat gccctgttga ttggggtcag tcattgtgag       720
     catggatttg aaccattgcc aggggttcag caggatattg cggttatgaa gcaagtccta       780
     gagaacccca aaatcgctgc ctttgatgag gtccaaaccc tactgaaccc caatccccag       840
     attttggcag aatccctaga aagcttttgc caagatcgag atattgatga tttgctcgta       900
     gtctattttt ctggtcatgg ggtggtgctg gatgatcatg gccggtttgg gttaaccact       960
     agtatgagcc gcaccaactc aaaaggtaaa gtggtgcggt caacccttgt ttcagccgat      1020
     ctgctccaag atattttgaa tgatagtaag gcagaacgac aggttgtagt tctagattgc      1080
     tgctatcgac aaactgacac ctctgctaat aatccccatc tagggggggt gaatctccct      1140
     caatatttag gggggttggg gcggacgatt atgacctcag cgactcaggc tcgccatgca      1200
     tttgtgcata agggggctga tctatccctt tacacatttt acttagtgga agggttaaga      1260
     accggggctg cagatcaaaa ttgtgacggc agtatttcgg tggaggaatg gtatgcctat      1320
     gggaagcgaa aggtcaaaca agagattcca gcgattgaac cgcaaattta taatgtcaag      1380
     gcggtgcaga atttagcttt ggctcaagct gccatcgatg aaccccaatt tgtctatcgc      1440
     cgtcagttcg aattctatgc gggtcgtggt gaggtatcgc cggtcaatcg ggtgattttg      1500
     gataatctcc agtccagcct tgatctggat atagagatgg ccaagataat tgaggcggag      1560
     gtgagtaaac cgggtaaagc ctatcagact aaactgcaag aatatgccat ggcctttgtg      1620
     gaggctgtgc gccaagaata tccggtcagt gattatttac aggatcagtt tcggcagttt      1680
     caagccacct tagggttaac ggatgcagat acgattccgg ttgaatcagc gattattcgt      1740
     caggttcagg tgatccaatt tcctggtcaa gcccctgaac cgccgagacg agcggtacct      1800
     agtacaacct ggtcaaatca aacggtgatt cagccgctcc atcaggcttt gggggttggg      1860
     caacagaccc tgaagacctc agctcagcgc ctgacttctc tggggcaaaa tctgtctatg      1920
     accgtgagtc agtctgtacg gaatgctcga tatcgggtga acctgtcttc cgtgtcttgg      1980
     cgtcaggtgc agtcggtgcc caagcgggta tggtggtttg cgggggcggg tgcgatcgca      2040
     cttctgctac taatgtctgt tctgcgtcaa caacaagagg cgcaacagcg gcagaaagag      2100
     gcacagcaga tggagttttg gcaatccctg gcccagcaga aacgctatga caactgtatt      2160
     gcccagactc aaaatattcc caaagattct cgactctatc cctctgctca gaaactattt      2220
     tcccaatgcc aagcgggtat caactggaag aatgctcaat taaaaacctt gtcgaatgcc      2280
     ccgaaacagg cgatttggtc cgttgccctc agcccagatg gcaagacctt gattggcagt      2340
     ggtgaccaaa acgatattaa gttgtggaac ttagggaaag gccagctcat ccgtactctg      2400
     tcagatcaca aagatcaggt ttggacgatt gccctaggcc ccaaaggcaa aatcttagcc      2460
     agtgctagtg gggattgcac gattaaactc tgggatgtac caaccgggaa gctgctgaga      2520
     acctttgcgg cccatccgat gactgtatgg tctgtagcca tcagccctga cggtacattg      2580
     ctggtcagtg ggagtgaaga tcgaacccta aaagtgtgga atatcaaaac gggcaagctc      2640
     gtccgcaccc tcaagggcca ttcaggacaa gtgcgatccg tggctattag ttcgaatggt      2700
     caaatgattg ccagtgccag cagcgataag acggtgaagt tatgggagct gaagacgggc      2760
     aaactccttc ggacatttaa gggacatacg ggtcgggtga tttccattgc ctttggacct      2820
     tccagccagc ggttagccag tgccagtcag gataagaccg tgaagctctg ggatctgaaa      2880
     tctggaaaat taaatcgaac cattcaggaa cataccaagc cggtgaccgc ggtgaccttt      2940
     agtcccgatg ggaatacatt ggcaacaggg agtttagatc ggacggttaa actctggaat      3000
     ctttctacgg gggccttgcg tcataccctt acaggttacc aaggtgatat ttattccttg      3060
     gcttttgccg ctgatggtca gtctttggtc agtagcagta aaaatagtgc cattaaagtc      3120
     tggagtcggg attag                                                       3135
//

If you have problems or comments...

PBIL Back to PBIL home page