(data stored in ACNUC8465 zone)

EMBL: CP000828.PE201

CP000828.PE201       Location/Qualifiers
FT   CDS_pept        complement(205328..206068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0206"
FT                   /product="DJ-1/PfpI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25292"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7N2"
FT                   /protein_id="ABW25292.1"
FT                   /translation="MSKHILMIVSNSATSNIGKPVGICAVELIHPYAVLKASGCQVTIA
FT                   SSQGGPIELDAQSEPRDPSGFLSLDILSARYITQAAFTDQLSNTPAISNLNTQDYDAIF
FT                   VCGGQGTLYTFPKDKALTDLFVSFYQDEKPSATLCRGACLLLNATLDNGEPLIQGKMIT
FT                   GFSKKEEQWMSKNFGPMMVPFVVEEEAKKRGAKFVASSAFTPFVIQDSNLITGQQSNSA
FT                   FLTASLVLKALDLDFNDSYFDNSH"
     atgtcaaagc acatcttaat gatcgtttcc aactctgcta ccagcaacat cggcaaaccc        60
     gtggggatct gtgctgttga actgatccat ccttacgctg tgctcaaagc ctctggctgc       120
     caggtgacca tcgcaagttc ccagggtggc ccgattgaac ttgatgcaca gagtgaacct       180
     cgtgatccgt ctgggttctt gtcgctggat atcctctctg ctcgatatat tacccaagcg       240
     gcgtttaccg atcagttatc gaatacccct gcgatctcaa atctcaatac acaggactat       300
     gatgcaatct ttgtttgtgg tggtcaggga accctctata ctttcccaaa agacaaggct       360
     ttgaccgatt tatttgtcag cttttaccaa gacgagaaac cgagtgcaac cctctgtcga       420
     ggcgcttgct tactcctgaa tgccaccttg gataatggcg aaccgttgat tcaaggcaaa       480
     atgatcactg gattctctaa gaaagaagag cagtggatga gtaaaaactt tggcccgatg       540
     atggttcctt ttgttgtaga agaggaggcc aaaaagcgcg gtgcaaaatt tgtggcgagt       600
     tctgccttca caccatttgt aattcaagac agcaacttga ttactggcca gcaaagcaat       660
     tctgctttcc taacggcgag cttagtctta aaggcgttgg atttagactt taatgattca       720
     tactttgaca attcacacta a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page