(data stored in ACNUC5340 zone)

EMBL: CP000828.PE203

CP000828.PE203       Location/Qualifiers
FT   CDS_pept        206719..206895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25294"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7N4"
FT                   /protein_id="ABW25294.1"
FT                   /translation="MEKVALRRYFLSKNKEVLQQYRDGRSAFNTSLDRLSYLLKNVRTQ
FT                   HPSSLFSIVNTIE"
     gtggagaaag tggctcttcg cagatatttt ctcagtaaga ataaagaagt tctccaacaa        60
     tatcgagacg ggcgatctgc ctttaacacc agcctagatc gtttgtccta tctcctcaaa       120
     aatgtcagaa ctcagcatcc tagttcacta ttctcaatag tcaatactat tgaatga          177
//

If you have problems or comments...

PBIL Back to PBIL home page