(data stored in ACNUC27125 zone)

EMBL: CP000828.PE207

CP000828.PE207       Location/Qualifiers
FT   CDS_pept        209523..209969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0212"
FT                   /product="globin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25298"
FT                   /db_xref="GOA:B0C7N8"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7N8"
FT                   /protein_id="ABW25298.1"
FT                   /translation="MALQTELLTNSFDLLRENEAEFTQVFYGTLFTDYPQVKPLFSNTH
FT                   MDEQAKKLFASLLLVVNNLTKPDALSSALKGLGTRHVKYGVLPEHYPLVGSTLLKSMAA
FT                   TLKDQWTPDIEAAWTDAYGAITEIMLEGTDYPEEVLISESMSAT"
     atggcgctac aaacagaact tctgacaaat agctttgacc tgcttcgaga gaatgaagca        60
     gaattcaccc aagtgtttta cggcacatta tttacggact acccacaggt gaaaccgctg       120
     ttctccaaca ctcatatgga tgaacaggcc aagaaattat ttgcttctct actattagtg       180
     gtaaacaacc tgacaaagcc cgatgcgctt tcctcagctc tgaaaggttt aggcactcga       240
     catgtgaagt atggcgttct acccgaacat taccccctgg ttggtagcac cctcctcaaa       300
     tcaatggcag cgactctcaa agatcagtgg actccagata ttgaggcagc ctggactgat       360
     gcctatgggg cgatcactga aatcatgctg gaggggacgg attaccccga agaagtattg       420
     atctctgaaa gtatgtcagc aacttaa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page