(data stored in ACNUC27125 zone)

EMBL: CP000828.PE212

CP000828.PE212       Location/Qualifiers
FT   CDS_pept        212154..212531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25303"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7P3"
FT                   /protein_id="ABW25303.1"
FT                   /translation="MVDLVLEIARDRTTDPHKIATWMVTTSTSICHATFGTNDPMPLLS
FT                   LYIRALDTQYPATMQEIYQILANEGLVKYAPSSLKRDDFTSILWAAGSTFANGELKLIE
FT                   DKIYISPQGLQRLRSIWKAPT"
     atggtggatc tcgtgttgga gatagcccgt gaccggacta ccgatccgca taagattgcc        60
     acttggatgg tgacgacctc tacttccatc tgtcatgcaa ctttcgggac aaatgatccc       120
     atgcccttgc tctcactcta tatccgggca ttagataccc aatatccagc caccatgcag       180
     gaaatttatc aaatattagc caatgaaggc ttagtgaaat atgctccttc atcactgaaa       240
     cgtgacgact tcacgagtat cctctgggct gcgggttcga cctttgctaa cggcgaatta       300
     aaactgatag aagataagat ctatatcagc cctcaaggat tacagcgttt gagatcgatc       360
     tggaaagcac caacgtga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page