(data stored in ACNUC8465 zone)

EMBL: CP000828.PE216

CP000828.PE216       Location/Qualifiers
FT   CDS_pept        complement(217595..218452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0221"
FT                   /product="TPR domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25307"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7P7"
FT                   /protein_id="ABW25307.1"
FT                   /translation="MSDSCFLEPHQDLYSICLQQLLPIASERVQSVDLDWWNIESFLGL
FT                   AFHILLSETDSKLRSQVAQIIPLFGAKAVPNLVFIEQEHVLDADLKSLVNLTFSKIEPQ
FT                   QQVMGLIDMLKACEDQSLDYLIAQKLWEIGAVATEAVATLLADPDEQELALRLLAQFQQ
FT                   FHHQQVANLEALFEHSPDFDPPGSYGAIKQKAETLLKAAMQAESAAPRQAVALYTEALQ
FT                   LCSDHAQAYGSRGLLRAILGDPQGAMADFQAAAELFREQGKTANAEIALGYCKAMARQL
FT                   PHLD"
     atgtctgatt cttgcttctt agaaccccac caagatttat atagtatttg ccttcaacaa        60
     ctacttccaa ttgcgagtga aagagtacaa tccgttgacc tggactggtg gaatattgaa       120
     agttttttag gcttggcttt ccatatcttg ttaagtgaga cggattctaa acttcggtcc       180
     caagtcgctc aaataatacc gctgtttggt gctaaggcag tccccaactt agtcttcata       240
     gagcaagaac acgtcctgga tgctgatttg aaatctttgg tcaatttgac cttcagtaaa       300
     attgagcctc agcaacaggt tatggggctg attgatatgc ttaaagcttg tgaagatcag       360
     agccttgact acctcatcgc ccaaaaatta tgggagatag gagctgtagc aactgaggca       420
     gtggcaacct tactagcaga tccagatgaa caagagcttg ccctaagact tttagcgcag       480
     ttccagcaat tccatcatca gcaagtggct aatctggaag ctctgtttga gcacagccca       540
     gattttgatc cccccggttc atacggtgca atcaaacaaa aagcagaaac gctacttaaa       600
     gcagcaatgc aagcggagag tgcggctcct aggcaggctg tggcactcta tacggaagca       660
     cttcaattgt gctctgacca tgcacaggct tatgggagtc gaggtttgct acgggccatc       720
     ttaggagacc cacaaggagc aatggctgat ttccaggccg ctgcggagtt atttcgagaa       780
     caaggtaaaa cggcaaatgc agaaattgct cttgggtatt gtaaagcaat ggctcgtcag       840
     ttgccccact tagattaa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page