(data stored in ACNUC5340 zone)

EMBL: CP000828.PE219

CP000828.PE219       Location/Qualifiers
FT   CDS_pept        complement(221175..223541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0224"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25310"
FT                   /db_xref="GOA:B0C7Q0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7Q0"
FT                   /protein_id="ABW25310.1"
FT                   /translation="MDFSTSSPKIQHFLVIEDELGKRTVPLIDSTCSLGRDPSNSIVIK
FT                   SPSVSRQHALLMRVTKPDIDSHLFRLIDGNLQGKRSMNGLTVNGQKCTTHDLNHGDEVM
FT                   FGQEVRARYYMTNNIADVHFLESCESDEVTGFLSNLHNPMQSQTPPSEVLAHSNEAAIV
FT                   RLASFPELFTNPIIESNLNGKITYLNPAAVAQFPQLREMQTDHPIMAGVTTLIGQEDEK
FT                   NFAREVEIGSQIFEQSVHYIAESDLIRTYIVDITKRKRMEAALKDSERRFKAIFNQTFQ
FT                   FSGLLNPDGILLEANQTALEFGGLHLDDVINTPLWETRWWSKSAETQSRLKNAVIEAAW
FT                   GKFVRYEVDILGAEDKVATIDFSLKPVHDEVDNVVLLIFEGRDISDHKQVESDLQRAHS
FT                   ELEQRVQQRTVELKQSNEHLRSEIVERQRAEAALQSSVATNRALINAMPDWMFRFSADG
FT                   IFVNYKDAPNTKLPLPSEAFLGKSLYDVFPKATAQPFMECIEKTLDRHEMQLFEYQFDA
FT                   EGNSFVFEARFAVSAENEVMAVIRDITERKRAEDDIRNALNKERELNELKSRFVAMTSH
FT                   EFRTPLATILSSAELLEHYGHKWDETRKLKHLSQIQQSVDHMTGLLNDVLLLGKAESGN
FT                   LAFNPVPMQLTEFCTGLAEELQITTQTHEIVCRLQEQLTEVQMDEKLLRHIFTNLLSNA
FT                   IKYSPQGGIINFDLVFESDEAILKVQDHGLGIPPSECSHVFNSFNRATNVGNISGTGLG
FT                   LAIVKRSVDLHGGEITLTSQETVGTIFTVRLPIYK"
     atggatttct ccacatcttc tccaaaaatt cagcattttc tagttattga agacgagcta        60
     gggaaacgaa ctgtcccact aatagattcg acttgctctc ttggtcgaga tcctagtaac       120
     tcgattgtga ttaaatcacc atcagtatct cgtcaacatg ccttgctgat gcgggtgact       180
     aaacctgata ttgatagcca tctttttcgt ttgattgatg gaaaccttca gggtaaacgg       240
     agcatgaatg gtttaacagt caacggccaa aagtgtacca cgcacgactt gaatcatggc       300
     gatgaagtca tgtttggtca ggaggtccgg gctcggtatt atatgacgaa caatattgcc       360
     gatgtccatt ttttagagtc ttgtgaatcg gatgaggtga cgggcttttt gtccaatctt       420
     cacaatccga tgcagagcca aacaccaccc agtgaagtac ttgcccactc caatgaggct       480
     gcaatcgtcc ggctagcctc cttcccagaa ctctttacga accccattat cgagagtaac       540
     ttaaacggta agattactta cttgaatccc gctgcggtgg cccagttccc acaattacgg       600
     gagatgcaaa ctgatcaccc aatcatggca ggggtaacga ctttaattgg ccaagaggac       660
     gaaaaaaact tcgctagaga agttgaaata ggatctcaaa tctttgagca atccgttcat       720
     tacattgcag agagtgattt gattcgaact tatatcgttg atattactaa acggaagaga       780
     atggaagctg cccttaagga tagtgagcga cgatttaagg ctatattcaa ccaaaccttc       840
     cagttctcgg gtcttctgaa ccccgatgga attttgttgg aggcgaatca aactgcttta       900
     gagtttgggg gtctccattt agacgacgtc attaatactc cactctggga aactcgatgg       960
     tggtctaaat cagcagaaac acaaagccga cttaaaaatg ctgttattga ggcagcttgg      1020
     ggaaagttcg ttcggtatga agtggatata cttggagccg aggacaaggt tgccactatc      1080
     gatttttcct taaagcccgt ccatgatgag gtggataatg ttgttttgct gattttcgaa      1140
     ggtcgtgata tcagcgatca caagcaagtt gaatcagact tacagcgagc acatagcgag      1200
     ctagagcaaa gagtccaaca acgaacggtt gaactcaagc agagtaatga acacttgaga      1260
     agcgagattg ttgagcgaca gcgcgctgaa gctgctttgc aatccagtgt tgccactaac      1320
     cgagccttaa ttaatgccat gcccgactgg atgtttcgat tcagtgcgga tggcattttt      1380
     gtcaattata aagatgcacc caatacgaaa ctgcccctgc ctagtgaagc attcttagga      1440
     aaatctcttt atgatgtttt ccccaaagct acggcccaac catttatgga gtgcattgaa      1500
     aaaacactcg ataggcatga gatgcagctg tttgaatatc agtttgacgc tgaaggaaac      1560
     tcgttcgtgt ttgaggctcg gtttgcagtc agtgctgaga atgaagtgat ggctgtgatt      1620
     cgcgatatca ctgaacgcaa acgagctgaa gacgatattc gcaacgcgct caacaaggaa      1680
     agggaactca atgaactcaa gtcacggttt gtggcgatga catcccatga atttaggaca      1740
     cccttggcaa cgatcctgtc ttctgcggag ttgttagagc actatggtca taagtgggat      1800
     gagactcgca agctcaagca tttaagtcaa attcagcaat ccgttgatca tatgacgggt      1860
     ttgctcaatg atgtactgtt actgggtaag gcagaatccg gtaaccttgc ttttaatccc      1920
     gtcccgatgc aactcaccga gttctgcaca ggtttggctg aagagttgca gatcacgacc      1980
     caaacccatg agattgtttg tcgtttgcaa gagcaattga ctgaagtgca aatggacgaa      2040
     aaattacttc gtcatatttt tacgaatcta ctatcgaatg ccatcaaata ctccccccag      2100
     gggggaataa tcaattttga tttagtgttt gaaagcgatg aagccattct caaggttcaa      2160
     gatcatggtt taggaattcc gccatcggaa tgtagtcatg tattcaattc ttttaatcga      2220
     gccacgaatg tgggtaatat ttcggggaca ggattaggct tggctattgt caaacgctcc      2280
     gttgacttgc atgggggtga aataacactc accagccaag aaacggtagg gacaatcttt      2340
     acggtgcgac tccccatcta taaataa                                          2367
//

If you have problems or comments...

PBIL Back to PBIL home page