(data stored in ACNUC5340 zone)

EMBL: CP000828.PE22

CP000828.PE22        Location/Qualifiers
FT   CDS_pept        complement(27421..28359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0024"
FT                   /product="nol1/nop2/sun family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25113"
FT                   /db_xref="GOA:B0C501"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0C501"
FT                   /protein_id="ABW25113.1"
FT                   /translation="MLTKFSLKLWPDPQQQQAFIQALTEPQPYSPCIAWIKGRSEKASF
FT                   QRVDALPWQLPFVDRLAVGERPGKHDLHHQGAYYCLDFSSVFAATPLTVIRKKPKVVLD
FT                   LCAAPGGKSLLAWRFLQPHLLVSNEVIGKRVGMLISNLKRCQIAPVRVLSADPSVLAEA
FT                   IPASADVVLVDAPCTGQSLLAKGESAPGCFHPASIQHNVKRQRRILANASRLVVPGGYL
FT                   AYMTCAFSEAENEQVCRWFTRRFPNFEPQTVDALLAFQSHLTDLPCYRIWPQSGLGAGA
FT                   FTMLFRNTQGTASMAQPLGAWLDENARWSSE"
     ttgttgacaa aatttagtct gaagttatgg cctgaccctc agcaacaaca agcatttata        60
     caggcattga cggagccaca gccctatagc ccttgtattg cttggatcaa agggcgatca       120
     gaaaaagcct cctttcagcg ggttgacgct cttccttggc agcttccctt tgtggatcga       180
     ctggcagtgg gagagcgtcc cggaaagcat gatttgcatc accagggagc ctattattgc       240
     ctagatttct cctcggtatt tgccgcaact cctctcacgg ttattcggaa aaagcctaaa       300
     gtcgtgctcg atctgtgtgc agctccggga gggaaaagcc ttttagcttg gcgattccta       360
     cagccccact tactggtgag taacgaagtg attggtaaac gggtgggaat gctcattagc       420
     aatttgaaac gatgtcaaat tgcacctgtg cgggtgttga gcgcggatcc atcagtacta       480
     gctgaagcga ttcctgccag tgctgatgtg gtgttagttg atgccccttg tacggggcaa       540
     tctttgttag caaaggggga gtctgcgccc ggttgttttc atcccgcgtc tatccaacat       600
     aatgtgaagc gacaaagacg catcctcgct aatgcctccc gtttggtggt gccgggagga       660
     tatttggcct atatgacctg tgcgttctct gaagcggaga atgagcaggt ctgtcgctgg       720
     tttactcgcc gcttccccaa cttcgaacct caaacggttg atgccttgtt ggcttttcaa       780
     tctcacctaa cggacctacc ttgttatcgg atatggcccc agtcaggttt gggagcaggt       840
     gctttcacca tgttatttcg caatacccaa gggacagcat ccatggctca acctttaggg       900
     gcatggctgg atgagaatgc tcgttggtct tctgaatag                              939
//

If you have problems or comments...

PBIL Back to PBIL home page