(data stored in ACNUC8465 zone)

EMBL: CP000828.PE222

CP000828.PE222       Location/Qualifiers
FT   CDS_pept        225836..226582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0227"
FT                   /product="FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25313"
FT                   /db_xref="GOA:B0C7Q3"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7Q3"
FT                   /protein_id="ABW25313.1"
FT                   /translation="MKKIKSEACEHHLLVIDDGKERRIVKLTEVAYSIGRDATNAIVLN
FT                   NPSISRQHAMLVRVPLPHQAHRYRIIDGNSQGKPSANGIYINGRPSSTRELETKDLINF
FT                   GKDIKATYLTLEMGQVELLNYIESLSYKSLKSDTLDHKATVFNSANVPVAELNTVLACH
FT                   HSPTPEQDHDSLQQAPLQAKETVRLSREEILKELNKPVSRQMWMVIAGAILSFCTLIGW
FT                   LMLDARKSSPALEFTQAPSSLGDARL"
     atgaaaaaaa tcaaatcaga ggcttgtgaa catcatctac tagtgattga tgatggaaag        60
     gaacggcgca ttgtcaagtt aaccgaagtt gcttattcaa tcggtcgaga cgcaaccaat       120
     gccattgtct tgaataatcc gtctatttcc agacaacatg ccatgctagt gagagtccct       180
     ctcccacatc aagctcatcg gtatcgcatc attgatggca attctcaggg taaacccagt       240
     gctaatggga tttacatcaa tggtcggcca tcttcaaccc gtgaacttga gacaaaagat       300
     ctcattaact ttggcaagga tattaaagcg acttatctca cgcttgagat gggccaagtg       360
     gaattgctga attatattga atcgctctct tacaagagcc ttaaatctga caccctagac       420
     cataaggcaa cggtgtttaa ttcagccaat gtaccagtgg ctgaattaaa caccgttcta       480
     gcatgtcatc attcacccac cccagaacag gaccatgact cgcttcagca ggctcctctt       540
     caggcaaaag agacggttcg gttatccaga gaggagatcc tcaaagagct aaataaacct       600
     gtcagccgtc aaatgtggat ggttatagct ggagcgatcc tatccttctg tacactaatc       660
     ggttggttga tgctcgatgc tagaaagagc agtccagcat tggaatttac ccaagcaccc       720
     agcagtttgg gggacgctag actttaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page