(data stored in ACNUC5340 zone)

EMBL: CP000828.PE223

CP000828.PE223       Location/Qualifiers
FT   CDS_pept        226802..227083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25314"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7Q4"
FT                   /protein_id="ABW25314.1"
FT                   /translation="MIAEDLIDYYLNNFNSSLDATGNAAVDIPILQSWDCVDINNQTKV
FT                   HGHLFQHHTLPPGKYLESSAVQRYFVYQGHVCVATKNSTYRLGIPLLF"
     atgatagctg aggatctgat tgactattat ttaaacaatt tcaattcatc ccttgatgcg        60
     actggaaacg ctgctgtgga tatacctatt cttcaatcat gggattgtgt tgatattaat       120
     aatcagacaa aagttcatgg gcatttattt cagcatcaca cacttccacc tggtaagtat       180
     ttagaatctt ctgctgttca gcgatatttt gtgtatcaag gtcatgtttg tgtggccact       240
     aaaaactcaa cctataggtt aggcattcct ctcctcttct aa                          282
//

If you have problems or comments...

PBIL Back to PBIL home page