(data stored in ACNUC27125 zone)

EMBL: CP000828.PE227

CP000828.PE227       Location/Qualifiers
FT   CDS_pept        229498..230028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25318"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7Q8"
FT                   /protein_id="ABW25318.1"
FT                   /translation="MQKISLGLGVGDACLLVDLDPWKVQSLLDEGQAVFESRGLETTGV
FT                   ISITKSEIKTPTEGLYLDYQKARIALKEKALTSIVKSKNIFQCHKGKLMLELFFGGEFN
FT                   SSSIKESEIQTTISVVMAYVMEQLGPSHKKALKAVLTSNKDILDIPKSEYRAIKRIAKK
FT                   IRSDKQMTIDFAA"
     atgcaaaaaa ttagcctggg cttaggagtg ggtgacgctt gccttttggt tgatttagac        60
     ccgtggaaag tccaatctct attggacgag ggtcaagctg tttttgagtc cagaggatta       120
     gaaactacag gcgttatttc tatcacgaaa tcggagataa aaaccccaac agagggtcta       180
     tacctggact accaaaaggc ccgaatcgcc ctcaaggaaa aggccctgac ttctatcgtc       240
     aagtctaaaa acatattcca atgtcataaa ggaaaattga tgttggagct atttttcggt       300
     ggtgaattta acagttctag tatcaaagaa tccgagattc aaacaactat tagtgtcgtt       360
     atggcctatg tcatggagca gctaggaccc agccacaaaa aagcattgaa agccgttcta       420
     acctccaaca aggacatttt agatatcccc aagtcagagt acagagcaat caagcgtatt       480
     gcaaaaaaga tacgctcaga taagcaaatg accatagatt tcgctgcata a                531
//

If you have problems or comments...

PBIL Back to PBIL home page