(data stored in ACNUC27125 zone)

EMBL: CP000828.PE229

CP000828.PE229       Location/Qualifiers
FT   CDS_pept        231144..231263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25320"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8T0"
FT                   /protein_id="ABW25320.1"
FT                   /translation="MLFSLVRGFYLAWVLLALDRVPLGSCRVQVRRFKGLQAL"
     atgctatttt ctctggtcag aggattttac ttggcttggg ttcttttggc cctggatcga        60
     gtccctttgg gaagttgccg agtccaggtt agaaggttta agggactgca agctctgtga       120
//

If you have problems or comments...

PBIL Back to PBIL home page