(data stored in ACNUC8465 zone)

EMBL: CP000828.PE23

CP000828.PE23        Location/Qualifiers
FT   CDS_pept        28533..29159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25114"
FT                   /db_xref="UniProtKB/TrEMBL:B0C502"
FT                   /protein_id="ABW25114.1"
FT                   /translation="MPEKQPDVLDQAFVKAAHAALTGSAPKTPTQSLIESLLQREKVAQ
FT                   SQSNLKFEQFIGAWRLCFVTGTKKPHQHQNKTVGNGFYIPRWVKMQIVYSPGNSTDYGP
FT                   KTSDTVGQIANQVHWAGLSLSLTGPARCWSKKNIMAFDFTRMEFKAFGRTLYQGFIRGG
FT                   QESEQTFWDGHVRTQAFFVYFLIQDQVLAARGRGGGIALWAKTET"
     atgccagaga aacaacccga tgtcctagat caggcgtttg tgaaagcagc ccatgctgcc        60
     ttaacggggt ctgcccccaa aactccgacc cagtccttaa ttgaatctct attacaacgg       120
     gaaaaggtag ctcaatctca gtcgaatctt aagtttgagc agtttatagg tgcctggcga       180
     ctttgttttg tgacaggaac gaaaaaaccc catcaacatc aaaacaaaac cgtcggtaac       240
     ggattctaca ttccccgctg ggtcaagatg caaatcgtct attcccccgg caactcgacc       300
     gattatggcc ccaaaacctc agacaccgtt ggacaaattg ccaaccaagt ccattgggca       360
     ggattgagct tatctttgac tggcccagct cgttgttggt caaaaaaaaa tattatggcc       420
     tttgacttta caaggatgga gtttaaggcc tttggtcgga ccctatatca gggatttatt       480
     cgaggaggcc aagagagcga acaaaccttt tgggatgggc atgtccgcac ccaagccttt       540
     tttgtttatt ttctgattca agatcaggtc cttgcggctc gtggtcgggg aggagggatt       600
     gccctatggg caaaaaccga gacctag                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page