(data stored in ACNUC5340 zone)

EMBL: CP000828.PE231

CP000828.PE231       Location/Qualifiers
FT   CDS_pept        complement(231763..232101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25322"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8T2"
FT                   /protein_id="ABW25322.1"
FT                   /translation="MTPQPITIKNGSKQGSYTFGALPIFFSVPNAGRFSNSHFFLSPIA
FT                   RSDKSGQYKIFEQWRLCQLRNPKFDYFGQNHFLDENDFVVLGTILDTQNQIDCIPKIQK
FT                   QIDYYFVF"
     ttgacgccgc aacccataac aataaaaaac ggctcaaagc agggcagtta tacctttggg        60
     gctttaccta ttttctttag tgttccaaat gcagggcgat tttctaatag tcatttcttc       120
     ctttccccga tagcaaggtc tgacaaaagc ggtcagtaca agatttttga acaatggcgt       180
     ttatgccaac tcagaaatcc aaaatttgat tactttggtc agaaccactt tttagacgaa       240
     aatgattttg tagttcttgg cacaattttg gatactcaaa atcaaatcga ttgcattccc       300
     aagattcaaa agcagattga ttactatttt gtattttga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page