(data stored in ACNUC27125 zone)

EMBL: CP000828.PE234

CP000828.PE234       Location/Qualifiers
FT   CDS_pept        complement(234120..239459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25325"
FT                   /db_xref="GOA:B0C8T5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8T5"
FT                   /protein_id="ABW25325.1"
FT                   /translation="MTHAERLAFLDSPAEKTASLEFNGLKGSTNVSASGAKKEAKVNPY
FT                   LIVPELVEGLSSAENLALRRKNTVDVRNPQPNRPEVLDELGLIAWGKPYDQVTSDLVCT
FT                   SNPDFLGAKAANLFFNELVGEHGRFLAAVDKWSGYRGFLGSSGVEELVRINDDGTRRWL
FT                   KDGSRAVYPVKLLKFLARAEGKAVTWFPHGQIKDRKATSLPGTMPDFIGLEIDDGCLNE
FT                   QLARLVTLQQFLGTKFLMLWSGKKSIHFYIPTIDHPESRDQYYEVLKTAISVTGGDYAV
FT                   ASAGRALRMAGAFRAVRVGNENVITNQSIMQLGSRDLSFSELNDGLLSFFRQEYGKDYR
FT                   SGKDWKYYQSLGLQIVKAPKGNNTIDVTGRKVTDVFLQSDEENDALLGGKRAKGIKAKK
FT                   VKAKAPKTPVEAVATQNVEEHKNLRLAQEARIAAGITGHGLTTEEILEVVSDPINQGLT
FT                   YHQKGTELSDRHQRWSILLGIYHSDGGTAEERYELAENFGVDNFGLDEAYVAKELGSTC
FT                   YSIGLSSIIRNIHGQVDGTWKPSERVRTLVAKSKNAANALEATNISEGLASLGEGVVPL
FT                   LTSDASQLDTEIELDNVKLQAIQLDRLTSLTLKGISTKCIDSQLRPEYTEVLKDRTIAL
FT                   HADVEGLGNDAQGLTRLKFNLMRTWFALEGNGCKVLVRIDSQKHLYTSLNELTGHLSKL
FT                   INQRIYQHTLPKLQDRAGSGVFNARYMAAGLIDGVKLADKIIEIHQDESKSNLFALSGP
FT                   TGTGKTTLVEQLLELLECKKFYAAPLKILALENGAALATDRNDEQAAEYEGLGLGDISA
FT                   CLQGFFNFGRFEKFATDKVVVFIDETDRVILDLLGSTHATQRQANLNQLKRILDHAKEN
FT                   DWPVIIAQQNLSEIAVRFFEWWMDVEANVFVNQYKEQFKDGLTLTQESYLGAVSAHLTG
FT                   DHEAFGFGKDSRLQFTQPKSVRRLDIHCQSANDILKFQEFTRPQRYLKHIFRDAKAKQA
FT                   LKELGAEDWDKYAKAPLFEIKAIDFSPEALKLWRFLEALQQPFWVDEVTDQHVLVKSTS
FT                   KKDTAGNEVTQHLVYWDFSPVGKYDGWIGGEKNHQKLKVEQWLETQDKGWTKELFVTQQ
FT                   RYGAPWQELLGMGLSWESAKALIRLMHEAFLDSKELVFPLFAATRDCMRSGKKTKELQN
FT                   VIAEGTKDGQHLMRSPLIGTGLSFYGDALDISATLVLASWGSLEDISQALSRNRSRPET
FT                   IVYAPRVLNNRVALDITQEWKDNHANQSRKNRAELKLLGKTGNRFNLNDAIACFEAIHG
FT                   RMEGFTYRALELFAQGRACAFACAGGGTLVLADNWLERFHKDRAFFGEFFNDVFLEWLF
FT                   GSKFAEDYLDVLDNVVECEDRVYEFFVFCAIEQEQIARHVEVTGSQSAKNLQGWEIKEG
FT                   TSFVDALSSSKNTGQFLSLVNAQRMAQLKYETYHFAECFLDHYADYTENGITFIERENL
FT                   KEYNSQGRVVFDGGREPDEIRSRQGDVACILENLRTHQYLQVVEESHFIQSEAEARRIK
FT                   NSPTSTVAEQRAADLALLRLEYPESQWSDPDFIYYTLVHKNGQLRSCATRLARYLLNSD
FT                   LFTKDQCQKFKRDAANGDHLHGVLRGTLREQIFINDSGVADFYRTHGRGNNISEAEVRE
FT                   SQFWAYLVEHQQELWDLFQLQTANDSPIAVINRLVKRLSYDPMPCVARTGNGGSQRRYA
FT                   AIVNKDVHEIRKQLLRGTVLYVKKQIDDACAKDCVDARSLADPLFYNSNDSLDRNSGSY
FT                   PKWFLEFRRSIEDQIAELDKLIE"
     atgactcatg ctgaacggct agctttctta gattctccag ccgagaaaac ggcatcctta        60
     gaatttaacg gcctcaaagg tagtacaaac gtttcagcga gtggagcaaa aaaagaggcc       120
     aaggttaatc cttatttgat tgttcctgag cttgttgagg gactgagttc tgctgagaac       180
     ttggcattgc gccgcaagaa taccgtggat gtcaggaatc ctcagcctaa ccgtccagag       240
     gtgttagacg agctgggatt gattgcttgg ggtaaaccct acgatcaagt gacctcggat       300
     ctggtttgca ctagcaatcc agacttcctg ggagccaagg cagcaaactt gttttttaat       360
     gagctggttg gtgagcatgg gcgctttttg gccgctgttg acaagtggtc aggatataga       420
     ggattcctag gaagctctgg tgttgaggag ctagtaagaa ttaatgatga tgggactcga       480
     agatggctca aggatgggtc gagggccgtg tacccagtga aactgctgaa gtttttagcc       540
     agggctgaag gaaaagccgt tacttggttc ccccacggtc agatcaaaga tcgtaaagcg       600
     accagtttac ctgggacaat gcctgatttc atagggctag agattgatga cggttgcttg       660
     aatgaacagc ttgccaggtt ggtgacgctg caacaatttc ttgggaccaa atttctgatg       720
     ttgtggtctg gcaaaaaatc cattcatttt tatatcccaa caatcgatca tcctgaaagc       780
     agggatcagt actacgaggt cttgaagacc gctatttctg tgacaggggg tgactatgcg       840
     gttgcttctg caggtagggc attgcgcatg gctggtgctt tccgtgcggt gcgggtcggc       900
     aatgagaatg tgatcactaa tcaatcgatc atgcaattgg ggtcgaggga cctatcgttc       960
     agtgagctga atgacgggct tttatccttt tttagacagg aatacgggaa agactaccga      1020
     agcggtaaag attggaagta ttaccagagc ttaggacttc agattgttaa agcccccaaa      1080
     ggtaacaaca ctatcgacgt aacgggccgt aaggtcactg atgttttcct acagtcagac      1140
     gaggagaacg acgccttact gggtgggaag cgggctaaag gtatcaaagc caagaaagtg      1200
     aaggccaaag ctcctaagac gcctgtggaa gctgttgcca ctcaaaacgt ggaggagcat      1260
     aaaaatttaa gactggctca agaagcgagg attgcagccg ggattacagg tcacggtctt      1320
     actacagaag aaattttgga ggttgtcagc gacccaatca atcaagggct aacctatcac      1380
     caaaagggta ctgaacttag tgatcgccac cagcgctggt caattctgct tggcatttat      1440
     cacagtgacg gcggaactgc ggaggagcga tacgaattag cagaaaattt tggtgttgat      1500
     aattttggtc tggatgaggc ttatgtcgct aaggagctgg gcagtacctg ttattcaatc      1560
     ggtctatcgt cgatcatcag gaatattcac ggccaagtag atgggacgtg gaagccttca      1620
     gaacgagtta gaacccttgt agctaaatca aagaatgctg ctaacgcatt ggaagcaacc      1680
     aatataagcg agggtttggc ttcattaggt gagggggttg tacctctgtt aaccagtgat      1740
     gccagtcagc tagatacaga gattgagctt gataacgtta aactccaggc gattcaactc      1800
     gatcgcttga catctttgac cctcaagggc atctcaacca aatgcatcga ctcgcagcta      1860
     agacctgagt acacagaggt cctaaaggat cgaactatcg cgctccatgc ggatgttgag      1920
     ggacttggta acgacgccca agggttgacc cggcttaagt tcaatctgat gcggacttgg      1980
     tttgcattgg aagggaatgg ttgcaaggtg ttggtgagga tagacagcca aaagcaccta      2040
     tacaccagcc tgaatgagct gacaggtcat ctgagtaagt tgattaatca gcggatttat      2100
     cagcatacat tgccaaagtt gcaggatcga gcagggtccg gggtgttcaa tgcccgatat      2160
     atggcagcgg gtctgattga cggggtgaag ctggctgaca agatcattga gattcatcag      2220
     gacgagtcta aatctaatct ttttgccctc agtggtccca ccggaacagg taagacaacg      2280
     ttagtagagc aattgcttga gctgttggag tgcaaaaagt tttatgctgc acccttgaaa      2340
     attttggcac ttgagaacgg ggctgcattg gcaacagata ggaacgacga acaagcggcg      2400
     gaatatgagg gtctaggatt aggtgacatc tcggcatgtt tgcaaggctt ttttaacttt      2460
     ggtcgttttg agaaatttgc tacggataag gttgtggtct ttattgatga gaccgatcgg      2520
     gtaatcctgg atcttttagg cagcacccac gccacccaac gacaggccaa tctcaatcag      2580
     ctcaagagga ttcttgatca tgccaaggag aatgattggc ccgtgatcat tgcccagcaa      2640
     aatctgagtg aaatcgcggt taggttcttc gagtggtgga tggatgtcga ggccaacgtc      2700
     tttgtcaatc aatataagga gcaattcaaa gacgggttga cgttgactca ggaaagttat      2760
     ctaggagcag tcagcgctca tttgacgggc gaccatgaag cttttgggtt tggcaaggat      2820
     agcagactac agttcactca gcctaaaagc gttcgtcggc tggatattca ctgccaaagt      2880
     gcaaatgaca tccttaagtt tcaggagttt actcgacctc aacgatatct caagcatatt      2940
     tttagggatg ccaaggctaa gcaagcgctt aaagagttgg gggctgaaga ttgggataag      3000
     tacgctaagg cccctctttt tgaaattaag gccatagact tcagcccgga ggcactgaag      3060
     ctatggcgtt tccttgaagc actacagcag ccattttggg tggatgaggt tacggatcag      3120
     catgtcttgg tgaagtctac cagcaaaaaa gatacggcag ggaatgaggt tacacagcac      3180
     ctggtttatt gggacttttc gccagttgga aagtatgacg gctggatcgg tggcgaaaag      3240
     aatcaccaaa agctgaaggt cgagcagtgg ttagagactc aagataaggg atggactaag      3300
     gagctatttg tcactcagca acgctatggg gcaccgtggc aagagctgtt agggatgggg      3360
     ctaagctggg agtcagccaa ggctttgatc cgattaatgc atgaggcatt tctagattct      3420
     aaggagctgg ttttccccct gtttgccgca acccgtgact gtatgagatc tggcaagaaa      3480
     acgaaggaat tgcagaatgt gattgccgaa gggaccaaag acggtcagca ccttatgaga      3540
     tcgccgctga ttggtacagg attgtcgttc tatggtgatg cacttgatat tagtgcaacg      3600
     ctggtattgg cgtcctgggg aagcctagag gatatctctc aggcgttgtc ccggaacaga      3660
     tcgagaccag agactattgt ttatgcacca agagttttaa ataatcgggt tgctttggat      3720
     atcacccaag agtggaaaga caatcatgct aatcagtccc gaaagaatcg agctgagttg      3780
     aagttactgg ggaaaacagg taatcgtttc aatcttaacg atgcgatcgc gtgctttgaa      3840
     gcaatccacg gacgtatgga aggctttacc taccgcgcac ttgagctatt tgctcagggt      3900
     agagcctgcg cttttgcttg tgctgggggt ggtacgcttg tactagccga caattggctt      3960
     gaaaggttcc acaaagatag agcctttttt ggggagttct tcaacgatgt tttcttagag      4020
     tggttgttcg gttctaagtt tgcagaggat tatctcgacg ttttggataa cgttgtcgaa      4080
     tgcgaagatc gagtttacga gttctttgtg ttctgcgcta ttgagcagga acaaattgcc      4140
     cgacatgtgg aagttacagg gagtcagtct gctaagaacc tgcagggctg ggagatcaag      4200
     gaaggtacat cttttgttga cgccctatcc agttcaaaga atacggggca atttctatcc      4260
     ctagtaaatg ctcaacggat ggcccaatta aaatacgaaa cttaccattt tgctgagtgc      4320
     tttcttgatc attatgccga ttacacagag aacggcatca cttttattga gcgtgaaaat      4380
     ctaaaagagt acaacagcca aggaagagtt gtttttgatg gtggcagaga accggacgaa      4440
     atcagatcac gtcaaggtga tgttgcctgc atccttgaga atctgagaac tcatcagtat      4500
     ctgcaagtcg tagaagaaag tcattttatt caaagcgagg cagaagcccg gagaataaaa      4560
     aattcaccta cttccacggt tgcagagcag agagcggctg acttggcctt attgagattg      4620
     gagtacccag agtctcaatg gtccgatcct gactttatct attacaccct cgtccacaag      4680
     aacggacagt tgagatcatg tgccacacgg ctagcccgat atttgctgaa ctccgatctt      4740
     tttacgaaag atcaatgtca aaaatttaag cgagatgccg ccaacggtga tcatttgcat      4800
     ggagtcctac ggggaaccct gagagaacag atttttatta atgattcggg ggtagccgat      4860
     ttttaccgca ctcatggccg gggcaacaat atcagtgaag ctgaggttag ggagtcccag      4920
     ttttgggctt atctcgttga acatcagcaa gagttatggg accttttcca gctccaaaca      4980
     gccaacgaca gccctatagc cgtcataaat cggcttgtaa agcgcctgag ctatgatccg      5040
     atgccctgtg tcgctcgaac gggtaacggg ggatctcagc gcagatatgc tgcgatcgtg      5100
     aacaaagacg ttcatgaaat ccgcaagcaa ctgcttcggg gcaccgtgct atacgtcaaa      5160
     aagcagattg atgacgcttg cgctaaagac tgtgtagacg cccgaagcct tgcagatcca      5220
     ctgttttata actctaatga ctctttagat agaaacagtg gatcttatcc caaatggttt      5280
     ctcgaattta gacgatcgat tgaagatcag atagcggaac tcgacaaatt gattgagtaa      5340
//

If you have problems or comments...

PBIL Back to PBIL home page