(data stored in ACNUC8465 zone)

EMBL: CP000828.PE238

CP000828.PE238       Location/Qualifiers
FT   CDS_pept        240623..240769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25329"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8T9"
FT                   /protein_id="ABW25329.1"
FT                   /translation="MPPASGVSCDSSKFGFGLDLLRNGIENLLDEALLAFLTDRPLKPS
FT                   ACQ"
     gtgcccccgg caagtggggt tagttgcgat tcctctaaat ttggttttgg cctcgacctg        60
     ctcagaaatg gaattgaaaa cttgttggat gaggctcttt tagccttttt gactgaccga       120
     ccgctgaaac ccagtgcctg tcagtga                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page