(data stored in ACNUC8465 zone)

EMBL: CP000828.PE239

CP000828.PE239       Location/Qualifiers
FT   CDS_pept        complement(240967..241812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25330"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8U0"
FT                   /protein_id="ABW25330.1"
FT                   /translation="MAGRKKKNQLARSSKKSTSTRKERINALSKHAVDGMPPDDIAERR
FT                   INEESQIKFNHLKKKYKEIFDALSDLNTYGEVILPRGLSVQKQRIFRLEVTQLEDLCAL
FT                   AQYSWTLIVTRKDSPLKTLEGIIDRKIDNPGDFIRTILTLEAAFDLWMCSPEFVGEALK
FT                   GKSQTSLASYRANERGKLKKLISHQLTGGSVELSDKLLALATKHLASDEERLSNLRHGS
FT                   RLWLLNWLGKLPKSIQHQYTLDNLLERYYRTKQRLDSEIANACNPRHGRTKKKLGRLAS
FT                   "
     atggcagggc gcaaaaagaa gaaccagtta gcccgatcaa gcaagaaatc gacatcaacc        60
     agaaaagaga ggattaatgc cttatctaag catgctgtag atgggatgcc cccggatgac       120
     attgccgaga gaaggatcaa cgaagaatca cagattaagt tcaaccatct aaaaaagaag       180
     tacaaagaga tctttgatgc gctctccgac ctcaatacat atggagaagt aatccttcct       240
     cggggactat ctgtccaaaa acaaagaatt tttaggttgg aagtaacgca actagaggac       300
     ctatgcgccc ttgcacagta ttcttggacc ctgattgtta cgagaaaaga ctcccctttg       360
     aaaacgttgg aagggattat cgatcgaaag attgacaacc caggtgattt tattcggaca       420
     attctcactt tagaggctgc tttcgacctg tggatgtgca gtcccgaatt cgtaggtgaa       480
     gccttaaaag gcaaaagtca aacatcttta gcgtcctacc gagcaaacga aaggggcaag       540
     ctcaagaagt taatcagtca ccagctaacc ggggggagtg tggagctgtc agataaactt       600
     ctcgccttgg ctactaaaca cttggcatct gacgaagaac gactatctaa ccttagacac       660
     ggttcgcggc tgtggctgtt gaattggctc ggtaaactac caaagtcaat acaacatcaa       720
     tacaccctcg ataacctact agaacgctac tacaggacta aacaaagact agactccgag       780
     attgctaatg cttgcaatcc tcgacacggt agaacaaaga aaaagcttgg gaggcttgct       840
     agttaa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page