(data stored in ACNUC5340 zone)

EMBL: CP000828.PE243

CP000828.PE243       Location/Qualifiers
FT   CDS_pept        244145..244789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0248"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25334"
FT                   /db_xref="InterPro:IPR010802"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8U4"
FT                   /protein_id="ABW25334.1"
FT                   /translation="MGLGAICTLSCLGLHTETALGATKIKFTYGPFGQSLTVQELKTFA
FT                   ETGKASSKLKFFMNAADQDPKVVRRFLTQDVKISLRLADRLLYLLPGEYALFQAGQIFQ
FT                   TPSQGANIQALRSGVIQSLSDDSQISLLEFLEKYPLAEMTIDGVKLARTADQIDRLVSR
FT                   FAPSVESGAAIATELLESLVCDCESGAIQPKPSVTAPNPIPEPAPDATPPG"
     atgggactgg gggctatttg taccttgtct tgtctaggcc ttcacaccga aacggccctg        60
     ggggccacca agattaaatt tacctatggg ccatttggtc aatccctcac ggtacaggaa       120
     ctcaagacct ttgctgaaac cggtaaagcc tcttccaaac tcaagttttt tatgaatgct       180
     gccgatcaag atccaaaggt cgtccgtcga tttttaactc aagatgtaaa aattagcctc       240
     agattggccg atcggttgct ctacttattg ccaggtgaat atgccttgtt tcaagcgggc       300
     cagatttttc agactccaag tcaaggggcc aatatccaag cccttcgctc gggggtgatt       360
     cagtccttga gcgatgatag tcagatttcc ctattggagt ttctggaaaa gtatcccctg       420
     gctgaaatga caattgatgg cgtcaagttg gcccgaaccg ccgatcagat tgatcgacta       480
     gtgagtcggt ttgcaccttc cgtggaatcc ggtgctgcga tcgcaactga acttctagaa       540
     agtttggttt gtgattgtga gtctggtgcg attcaaccaa aaccatctgt tactgcacct       600
     aatcccatcc ctgaaccagc ccctgacgcg acacctcccg gttga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page