(data stored in ACNUC5340 zone)

EMBL: CP000828.PE245

CP000828.PE245       Location/Qualifiers
FT   CDS_pept        246552..247544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0250"
FT                   /product="peptidase M23 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25336"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8U6"
FT                   /protein_id="ABW25336.1"
FT                   /translation="MRKYIFLLLLGLISVLGCELSTQANPTLQLGLPIDCTLGNDCFVL
FT                   LYTDRDPGPEAVDFGCGRMTYDGHKGTDFAIPDEQVMAEGVKVKAAAAGTVLRTRNNIR
FT                   DRRIQDQTQTDAVEGMECGNGVVIEHDENWQTQYCHLRKGSVLVQPGDKVKEGTPLGLV
FT                   GTSGKASFPHVHLSVRYQDRVVDPFVGPEAPSGCQGSKSPLWKTALPYQSTGLIRAGFA
FT                   TQLPELEQLWDGEFKDQVLPVDSPALVFWVHTYGMLKGDQERLQLRDPQGKIVAQFNRT
FT                   VSESQKVWTRSLGKKGTKQPLIPGQWSGRYQLIRDQKTIIDHEADVLLQ"
     gtgcgtaagt acatttttct actgctgttg ggattaatct ctgtcctggg atgtgaattg        60
     tcgacccaag cgaatcctac tttacagcta gggctaccca ttgattgcac cttaggtaat       120
     gactgctttg ttctgcttta tacggatcgt gatcctggcc cagaagcggt agattttggc       180
     tgtggccgga tgacatacga tggccacaaa gggaccgact ttgctatccc tgatgagcag       240
     gtaatggcgg agggagtcaa agtaaaagcc gccgccgcag ggacagtatt acgcactcgg       300
     aacaacattc gcgatcgccg cattcaggat caaactcaaa ccgacgccgt tgaaggaatg       360
     gaatgtggta acggtgttgt catagaacat gatgaaaact ggcagactca atattgtcat       420
     cttcggaaag gcagtgttct agttcaacca ggtgacaaag tgaaagaggg gacgcctcta       480
     ggtttagtgg gtacttctgg aaaggcttct tttccccatg ttcacttgag tgttcgctac       540
     caagatcggg ttgtggatcc gtttgtggga ccggaagccc catcagggtg tcagggtagc       600
     aagagtcctt tatggaaaac ggcccttccc tatcaatcaa cgggattgat ccgggctggc       660
     tttgcaacgc aacttccaga gctagaacaa ttatgggatg gagaatttaa agatcaagtg       720
     cttccagtgg atagccctgc cctggtgttt tgggtccaca cctatggaat gctcaaagga       780
     gatcaagaac gcctgcagct ccgagatcct cagggtaaga ttgtcgctca gtttaatcga       840
     acagtatcgg aatctcagaa ggtatggacc cgttcattag ggaagaaggg cactaagcaa       900
     ccccttattc caggtcagtg gtctggacgg taccagttga ttagagacca gaaaacgatc       960
     attgatcatg aagcagatgt gcttttgcaa tag                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page