(data stored in ACNUC8465 zone)

EMBL: CP000828.PE246

CP000828.PE246       Location/Qualifiers
FT   CDS_pept        complement(247652..248512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25337"
FT                   /db_xref="GOA:B0C8U7"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8U7"
FT                   /protein_id="ABW25337.1"
FT                   /translation="MYLPEDYQSLRKWQVICSHCYSLYQAEPGVVIGSWLGFSRNHQNI
FT                   YLARIQMRTGSIKTVEIDQLIGANIPIILMMPAKGVGHLQPILLVDVKTNQSHFLPHPQ
FT                   RQFLKYQRYTVIGVSIFILCLGLSIRGGVATIIIVAVVGSLLVGNILPRILRSKQHNSK
FT                   TQNRLMLEQRLIKQSDAWGEQLQQLEIELTKLHQANKRLLPYSQDEAFHIRSISDKPRK
FT                   RQYFQSKYYRLSELVECYVLTKNLIDINIPIIQLAEEVPVDLISQLSNLSLQIKDLERR
FT                   YQSMT"
     ttgtacttac cagaagacta tcagtctctg agaaaatggc aagtcatttg ttcccattgc        60
     tattcactct accaagctga gcctggtgtc gttattggct catggttggg gttttcccgt       120
     aatcaccaaa atatttatct agctagaatt cagatgagaa ctgggtctat taaaacagta       180
     gaaattgatc aactcatcgg tgcaaatatt ccaattattt tgatgatgcc ggcaaaaggt       240
     gttggtcact tacagcccat tttattagta gatgtcaaga ccaaccagtc tcacttcttg       300
     ccccatcctc aacggcaatt tctcaaatat caacgatata ccgtgattgg ggtcagtata       360
     tttattcttt gcttaggttt atcgattcga ggaggggtag ctacaattat cattgtggcg       420
     gttgtcggta gccttttagt aggtaatatt ttgccaagaa tcttgcgaag caagcaacac       480
     aactccaaaa cacaaaatcg tttgatgttg gagcaacgac tcattaaaca aagtgatgcc       540
     tggggagaac agctccaaca actggaaata gaattaacaa aattgcatca agctaataaa       600
     aggctacttc catatagcca agatgaagcc tttcacatca gatcaatttc agataagccc       660
     agaaaacgcc agtactttca gagtaaatat tacagactca gcgaattggt tgagtgttat       720
     gtcttaacaa aaaacttaat tgatattaat atccctatta tccaattagc cgaagaagtg       780
     ccagttgacc taatcagtca actatctaac ctctctttgc agattaagga tctagagcgt       840
     cggtatcaat ccatgaccta g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page