(data stored in ACNUC27125 zone)

EMBL: CP000828.PE249

CP000828.PE249       Location/Qualifiers
FT   CDS_pept        250366..251289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0254"
FT                   /product="DUF6 domain transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25340"
FT                   /db_xref="GOA:B0C8V0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8V0"
FT                   /protein_id="ABW25340.1"
FT                   /translation="MTQLKSTGKKVGSYGVKPNPYAFIALLLGAIGIAFAPIFVRLSEL
FT                   GPSATAFYRLGFAVPLLGVWLWTSRPATSFPVNEQRVTGLPLISAGCFFAADLAVWHWS
FT                   IQFTSVANATLLANFAPIFVVLGGWLLFGETVSRWFLVAIALVLLGATLLVSASIDTQH
FT                   VFGDALGLLTAIFYAGYILSVARLRLHFPTATIAFACSIVGATILFFIAWLSGEGFLPM
FT                   TMTGWLSLVGLACISQVIGQSLIMFALAHLPSAFASVSLLLQPVTAAILAWRLFGEALT
FT                   LQQGFGGVIVLAGIVLARWSDRKPVS"
     atgacccagc ttaaatcgac aggaaaaaaa gtggggtctt atggtgttaa gcccaatccc        60
     tatgctttca tagcgttgct tctgggggct attggtattg catttgctcc catttttgtg       120
     cgcctgagtg aattagggcc gagtgcaaca gcattctatc gattgggatt tgctgtccct       180
     ctattgggag tttggttatg gacctcccga cctgctacat ccttccccgt gaatgaacag       240
     cgtgtaacgg ggttgcctct gatatcagca gggtgtttct ttgcagcaga tttggcggtt       300
     tggcattggt ctattcaatt tacctctgtt gccaatgcaa ccttgttggc taacttcgcc       360
     cctatttttg tggtgttagg gggttggcta ctgtttgggg aaactgtttc acgatggttt       420
     ttggttgcca ttgctctagt tctcttaggg gcgaccctat tagtcagtgc gagtatcgat       480
     actcaacatg tatttgggga tgccttagga ctgcttacgg ccattttcta cgctggatat       540
     attctgtctg tggctcggtt acgtttgcat ttcccgacag caactatcgc ctttgcctgc       600
     agcatcgttg gagctacgat tttgtttttt atcgcttggc tgtcgggaga aggattctta       660
     cctatgacga tgactgggtg gttatcgtta gtgggattag cctgtatttc gcaggtgatc       720
     ggccaaagtt tgattatgtt tgctttggcc catttgcctt ccgcatttgc ttcagtcagt       780
     ttgctgctac aaccggttac ggcggcaatt ttagcttggc gattgtttgg ggaggcgctg       840
     accctgcagc aaggctttgg gggcgttatt gtattggcag ggattgttct ggctcgttgg       900
     agcgatcgca aacccgtatc atag                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page