(data stored in ACNUC27125 zone)

EMBL: CP000828.PE250

CP000828.PE250       Location/Qualifiers
FT   CDS_pept        251320..251811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0255"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25341"
FT                   /db_xref="GOA:B0C8V1"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8V1"
FT                   /protein_id="ABW25341.1"
FT                   /translation="MQCSTQQLIAQPITPETFQPYGQVIFASEDGAVYGPDNAQLHLDQ
FT                   GIPRFYIVRLEKLGRRFSRITRHLKCTQCLGSLAGKPWLMAVAPPGDAAQPALDQITAF
FT                   QIPGDCFIKLEVGTWHAGPHFDTDFIDFYNLELSDTNQVDHDTCNLINQYNVEFIITPM
FT                   "
     atgcaatgct ctacgcaaca actaattgct caaccaatta ctccagagac atttcaaccc        60
     tacggtcagg tcatatttgc ttccgaagat ggggccgttt atggtcctga caatgctcaa       120
     ttacatttag atcaggggat tccccggttc tatattgtgc gactagaaaa attgggccga       180
     cggttttctc gcattacgcg gcatctaaaa tgtacccaat gtttagggtc tctagctggt       240
     aaaccttggc tgatggccgt tgctccccca ggagatgctg ctcaacctgc cctagaccag       300
     atcacggcat ttcaaattcc tggagactgc tttatcaaat tagaagtggg gacctggcat       360
     gcgggtcctc acttcgatac cgactttatc gatttctata atttagaact gtctgacacc       420
     aatcaagttg atcacgatac atgtaacttg atcaaccaat ataatgttga attcatcatc       480
     acgcccatgt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page