(data stored in ACNUC5340 zone)

EMBL: CP000828.PE251

CP000828.PE251       Location/Qualifiers
FT   CDS_pept        251883..252749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0256"
FT                   /product="K+ channel, inward rectifier protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25342"
FT                   /db_xref="GOA:B0C8V2"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR013518"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016449"
FT                   /db_xref="InterPro:IPR041647"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8V2"
FT                   /protein_id="ABW25342.1"
FT                   /translation="MPQKSYLKFQDGKFSISGLGVWYTYWRDPYHLLLTIPWLGFLLIL
FT                   VGGYLVINVLFALAYLAGGDCIANATPGSFWDAFFFSVQTLGAIGYGAMHPTTAYANFV
FT                   VTIEAFTSILSVALITGLAFARFSRPTTRVLFSHVAVITPYNGVPTLMFRTANQRRNQI
FT                   LEAEINLYFLQDEISTEGDAMRHLYNLNLLRPRTPSFTLTWTVMHPIDESSPLYGATAE
FT                   SLERTKATLIVTLTGIDDTVAQSLHARHTYGALDIIWDHKFIDIFHQTPDGHRYIDYTH
FT                   FHDVAPK"
     ttgcctcaaa agagctactt gaaatttcaa gacggcaaat ttagtatttc tgggctgggg        60
     gtttggtata cctattggcg cgatccttat catttattac tgacgattcc ttggctgggc       120
     tttctgctaa ttctggtcgg cggctattta gtcattaatg tattgtttgc actggcctat       180
     ctggctgggg gagattgtat cgccaatgcg acaccgggct cgttttggga tgccttcttc       240
     ttcagtgtgc aaactttggg ggccattggt tatggagcca tgcaccctac cacggcttat       300
     gccaattttg tggttacgat tgaggccttt actagcatcc ttagtgtggc cttaattaca       360
     ggtttggcgt ttgcgagatt ttctcgaccg acaacccgag tgttgtttag ccatgttgcc       420
     gtgattacac cttacaatgg cgtcccaacc ttgatgttcc gcaccgccaa ccagcgtcgt       480
     aaccagattc ttgaagctga aattaatctc tattttctgc aagatgaaat cagcactgag       540
     ggagacgcga tgcggcattt gtataatctc aatttgcttc gtcctcgaac gccttcattc       600
     accctgactt ggacggttat gcatccgatt gatgaatcta gtccactcta tggtgctact       660
     gctgaatccc ttgaacgtac aaaagcaacc ttaattgtga cattgactgg aattgatgat       720
     acagtggctc aatctttgca tgctcgccat acttatggag ccctggatat tatttgggat       780
     cataagttta ttgatatttt ccatcaaact ccagatgggc atcggtatat tgactatacc       840
     cactttcacg atgtcgctcc caagtga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page