(data stored in ACNUC8465 zone)

EMBL: CP000828.PE253

CP000828.PE253       Location/Qualifiers
FT   CDS_pept        complement(255290..257341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0258"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25344"
FT                   /db_xref="GOA:B0C8V4"
FT                   /db_xref="InterPro:IPR025295"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8V4"
FT                   /protein_id="ABW25344.1"
FT                   /translation="MQTHQTQSQQAKTEAVPSSTPPVTQPTSPSPIVEPKSNAEGLAEH
FT                   AERLEKFQRLDTSMVQMGPPRLTNGNPIQPKLTIGAPGDKYEQEADRVAKQVVTQMHSP
FT                   KGLNPPSSAQRQDLPEQDELMMKPIIQRHNGPKDANPNLEHAINQSRGGGRPLDDKIRG
FT                   PMEQAFGANFGGVRVHSDRKAHQLNESIQARAFTTGQDLFFRQGAYQPSSRAGQELLAH
FT                   ELTHVVQQNGKSIQPSLHPQSTAAEPQQNQEPTPSKSMELCWKSNDVFLRRQSEKQNHV
FT                   SQAKNNVIPYITDKRIHQTSSTNGRLQKTEHLFQQVPAQPQYALVEKRQPKSTVIDSIS
FT                   SNPSPSIQRELADSWNQDEELYKLKDQIHGLQWYFNPDTQRFYYLVEGQAADTETAAEN
FT                   KMSLQSLHTFWVGYALAERDAASWREEANKDETGLLNSRIPWEGFIDAVGEDLGQENAE
FT                   SADNADTSTIFGKIGGLFKAAKPNAKTNKWRLGAEGIGHLAGGAIILALTVPAIGSGAG
FT                   AIIGVPAAIGGGIQIVIGLSKFGRAWLAHKKGKEKDEDKIQKYGKWFNNLITMEGLLSL
FT                   AFNTFMAIATGGAAASILGASGGLIKAVRGALLHIDDFDKKHPNLVALMTSVEAILTAI
FT                   GRVLGIVIGAATEGAALAKNIVLGLVATIKESRAAASWRKAKAAAEAQ"
     gtgcagacgc atcaaactca gtcacagcaa gccaaaacag aggctgtccc ttcttctacc        60
     ccacccgtta ctcaaccgac atccccatcc cccatcgtag aacctaagtc gaatgctgaa       120
     ggtctagcag aacatgcaga acgactggag aaatttcaga gattagatac cagtatggtg       180
     cagatggggc caccacgctt aaccaatgga aaccccattc aacccaaact gaccattgga       240
     gcaccgggag ataaatatga acaagaggcc gaccgcgtgg ccaagcaggt cgtcacccaa       300
     atgcattctc ccaagggcct aaatcctcca tcatctgctc aacgtcagga tttacctgaa       360
     caagatgagc tgatgatgaa acccattatt caacgacaca atggccctaa agatgcgaac       420
     cccaacctag aacatgccat taaccaatct agagggggtg gtcgtcccct ggacgataag       480
     atccgcggtc caatggaaca agcttttgga gcaaattttg gtggcgtgcg agtccatagc       540
     gatcgcaaag cgcatcaact caacgaatct attcaagccc gtgcctttac cacaggccaa       600
     gatcttttct ttcgccaagg agcctaccaa ccgagtagcc gagcaggcca ggaactcctc       660
     gcccatgaac tgactcatgt cgttcagcag aatggcaaat ctatccagcc atcactacac       720
     ccccaatcaa ctgcagctga accccaacaa aatcaggagc caacaccatc caagtcaatg       780
     gaactgtgtt ggaaatccaa tgatgtcttc ctgaggaggc agtcggagaa acaaaaccat       840
     gtctctcagg caaagaacaa cgttattcca tacataactg ataaacgcat ccatcaaact       900
     tcttccacca atggcaggct tcagaagacg gagcatcttt ttcaacaagt ccctgctcag       960
     cctcaatatg ctttggttga gaaacggcag cccaaatcca cagttataga ctctatttct      1020
     tctaatccat ccccttctat tcagcgggag ttagccgata gttggaatca agatgaagaa      1080
     ctctacaaac tcaaagatca aattcatgga ttgcaatggt acttcaatcc agacactcaa      1140
     agattctact atcttgtaga aggacaagct gcagatacag agaccgcagc agaaaataag      1200
     atgtctttac aaagcctgca tacattttgg gttggatacg ccctggcaga gagagatgca      1260
     gcaagctggc gtgaagaagc caataaagat gaaactggtt tactcaattc ccgaattcct      1320
     tgggaaggat ttattgatgc agtgggggag gatttgggcc aggagaacgc tgagtcagca      1380
     gataatgcag atacctcgac gatttttgga aaaattgggg ggcttttcaa agcagcaaag      1440
     cctaatgcaa aaaccaataa gtggcgatta ggggctgaag ggattggcca tttagctgga      1500
     ggggcaatta ttctagctct gactgtacca gctattggaa gtggagccgg ggcaattatt      1560
     ggtgttccag cagctattgg tggtggtata caaattgtga ttgggctttc taagtttggc      1620
     cgagcatggc tagctcataa aaaagggaaa gaaaaagatg aggacaaaat ccaaaaatat      1680
     ggaaaatggt tcaataattt aatcacgatg gaaggattgc tgagcttagc gttcaacaca      1740
     tttatggcaa ttgccacagg aggagctgcc gcctcaattc ttggagcatc tggtggactc      1800
     attaaagcag tgagaggagc tttacttcat attgatgatt ttgataaaaa gcaccccaat      1860
     ttagttgcat taatgacttc tgttgaagcg attctaactg ctataggtcg agtactagga      1920
     attgtcatcg gagctgctac ggaaggagct gcattggcaa aaaatattgt tctaggacta      1980
     gttgcgacta ttaaggaaag tcgggctgca gcaagttgga gaaaagctaa agcggcagca      2040
     gaggctcaat aa                                                          2052
//

If you have problems or comments...

PBIL Back to PBIL home page