(data stored in ACNUC8465 zone)

EMBL: CP000828.PE254

CP000828.PE254       Location/Qualifiers
FT   CDS_pept        complement(257480..259111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25345"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8V5"
FT                   /protein_id="ABW25345.1"
FT                   /translation="MRTYCHRQKKKTRHLAQPTKIDKPSQSLEQPPTLQERSNEAGLAE
FT                   WAAQQQKWAKIGNTLLDQPPGNSPQPWLQPQRDKNTTSPSEPSANLHISPMMGANPPIQ
FT                   RLMDVKSFQEATKGTLFHPRKRITAIDDPLKKIDQSGMDSILLNELLEAINGWLKVASE
FT                   DSTRKPVVLQLREEVMTELEKIATSLSQDFDPENPPPTRSRRNAFSAEVTGAGKKYGSD
FT                   FSDFDSKQFRVSGRAPQRRIEEVKRLKMEDGTVVYYATGLVTNFKGKAPMVAPYPDPIP
FT                   LGDWYPKVTHINGMAVAPKSGLLSAAALQETVNTALGGKEDVAFGQDAVDILYTYSAQR
FT                   GNVVFDLIDCIKGKLQIEDEATGKQEDIMLDAVRSKKRVTVSAHSRGTIKTDNAVRNVH
FT                   EILTKELLPSIRAARQEEVMAYWQANDPQIGLSADMLAELSYSGFAAEEAKKQLNTYIQ
FT                   LIYAGNAVQHPSAFIDVKLFVGGLDLVSMFVGTYSETGRKIDSIIGTGGSKKSKLKSVG
FT                   GTKGHGFVGNYVPTVGQEIAQDLQQR"
     atgcgaacct actgtcatcg gcagaagaaa aaaactcgtc atctcgctca gccaacaaaa        60
     atagacaagc cctctcagag cttggaacaa ccgccaacgc tgcaagagag gtctaatgaa       120
     gctggactag cagaatgggc tgcccagcaa cagaaatggg ccaagatagg gaatactttg       180
     ttggaccaac cgcctgggaa ctctccccaa ccttggcttc agcctcagcg agacaaaaat       240
     acaacttctc cgtctgaacc atcagcaaac cttcatattt ctcccatgat gggtgccaat       300
     cctcccattc agcggttgat ggatgttaaa agctttcagg aagcgactaa agggacattg       360
     tttcatcccc gtaaacgaat tactgccatt gatgatcccc tcaaaaagat tgatcaatcg       420
     ggaatggata gtattctgct caacgaattg ctagaagcca ttaatggttg gctcaaagtc       480
     gctagcgaag acagcacccg aaaacctgtt gtcctccagc ttcgagaaga agtgatgaca       540
     gaattggaga aaattgccac ttccctcagt caggattttg atccagagaa tccaccgcca       600
     actcgatctc gacgtaacgc cttttctgca gaagtcactg gcgcaggcaa aaaatatggc       660
     tcagacttta gcgatttcga cagtaagcaa tttcgagtct cagggcgagc acctcaacgc       720
     cgcatcgaag aagtcaaacg cctgaagatg gaagatggaa cagtcgttta ctatgccact       780
     ggactggtga ctaactttaa gggcaaagca cccatggttg ccccttatcc cgatcccatt       840
     cccttggggg attggtatcc aaaagtcacc catatcaacg gcatggctgt ggctccaaaa       900
     tctggcttac tcagcgctgc agctttgcaa gaaaccgtta atacggccct aggtgggaaa       960
     gaggacgttg cttttggtca ggatgcggtt gatattctgt acacctacag cgcccagcgt      1020
     ggcaatgttg tttttgattt gatcgactgc atcaaaggca agctccaaat cgaggatgaa      1080
     gccacgggca agcaagaaga cattatgctg gatgcggtcc gcagcaaaaa gcgggtaaca      1140
     gtttctgccc atagtcgagg caccatcaag accgacaatg ctgttcgcaa tgttcatgaa      1200
     atattgacaa aggaattatt gccctccatc agggcagctc gacaagaaga agtgatggcc      1260
     tattggcaag ccaacgatcc gcaaattggg ttgtcagcgg atatgcttgc tgaactcagc      1320
     tacagtggct ttgccgcaga agaagcaaag aaacagttga atacttatat tcagctaatc      1380
     tatgcaggaa atgccgttca acatccttcc gcttttatcg atgtcaagct gtttgtgggt      1440
     ggccttgatc tggtcagcat gtttgtgggc acttacagcg aaacaggtcg aaagatcgac      1500
     tcgattattg gcacaggcgg ctccaagaaa tcgaagctaa agagtgttgg tggtacaaaa      1560
     ggacatggct ttgtcggcaa ctatgttcct accgttggcc aggaaatagc ccaagatctt      1620
     caacagcgat ag                                                          1632
//

If you have problems or comments...

PBIL Back to PBIL home page