(data stored in ACNUC27125 zone)

EMBL: CP000828.PE256

CP000828.PE256       Location/Qualifiers
FT   CDS_pept        complement(259625..260017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25347"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKJ3"
FT                   /protein_id="ABW25347.1"
FT                   /translation="MFYFLMQCPLCGHPKTHKHGKTSKGSQRYRCPHCQQTFSETFDTL
FT                   CYRRQISPETIQTILQAHVEGSSLRGLSRITGVAYNTCVSVVRSASHKSQMIHNGEVQA
FT                   VATDVINADELWSFVKKSKSTVSRRS"
     ttgttttatt tcctcatgca atgtcctcta tgtggtcatc ctaaaaccca caaacatggc        60
     aagaccagca aaggcagtca acgttaccgt tgcccccact gtcaacagac ctttagtgag       120
     acctttgaca ccctgtgtta tcgccgtcag atctctcctg aaacgatcca gaccatcctt       180
     caagctcatg ttgaagggag tagtctacga ggactctctc gcatcacggg tgtagcgtat       240
     aacacttgtg tgagtgtggt tcgttcagcg agtcataaat cccaaatgat tcacaatggg       300
     gaagttcagg ccgttgcgac cgacgtcatt aatgcagatg agttgtggtc ctttgtcaaa       360
     aaaagcaaaa gcactgtgag ccgaaggagt tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page