(data stored in ACNUC27125 zone)

EMBL: CP000828.PE257

CP000828.PE257       Location/Qualifiers
FT   CDS_pept        complement(260350..262431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25348"
FT                   /db_xref="InterPro:IPR025295"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8V8"
FT                   /protein_id="ABW25348.1"
FT                   /translation="MLLLASLSGLSVAKSSSEEVLMMRTQTSRSKKPTSQKLPQAKEVT
FT                   QPPLVEVPLMQASDEEGLAAWEKQRQKWERFGTPWMDKVPNLSGEINQPWIQPKLTIGQ
FT                   PNDKYEKEADRVAKQVVTNTNYPDFVNVPQGRSGQHQGWVIDNLQAKPEVFAKQQGPKS
FT                   IGGTLPVNLESAINQARGSGRQLDVSLQQSMGQVMNADFSRVRVHTDVQSDRLSQSIQA
FT                   KAFTTGQDVFFRKGEYQPHSKYGQELIAHELTHVVQQQGQSVSSSNIQRAIDWQVQDYF
FT                   FKIGPEPKLGIVKDPNSLYQYLNEWINRIEPWVKSIIENKIDANYYQSLKLEDKNDFDR
FT                   LKYEKNTWDEIVKGWNKIKPGKIKEYISFLADKSSESLLSKVVIGRLKESTGQSTAGQR
FT                   YTYRFYYLEDAFRAILAEDYRKESTKKEDKLADEVLSSDIEKQIEFWIVGFINNFTKDA
FT                   RYLKVKEFMIDAEYKDYFGGKISDVLDNPENKSISELISALHDATTILFEMSEVIYQID
FT                   NPQYKPRDKYLVQHGEKINFYKLIDKGGISKEVANYVAVPPDKDKANYYINLNNNSNNN
FT                   NSNYQNQEDIKYVRPGYLNESKSEVLKQLRKNKMLVEIGPSYTTGRLMQLSDTFGAGPK
FT                   TKLAIALAIFAFWNKGYDKAVSGIHRFHFVMDMCKNYVPQLKYENEYPNSIAEIWNSL"
     ttgcttttac ttgccagtct gagtggattg agtgtggcca aatctagttc tgaggaagtt        60
     ttgatgatgc gtactcaaac ctcacgttca aagaagccca cttcgcagaa attaccccaa       120
     gccaaagagg ttactcagcc cccattggtc gaagttcctc tgatgcaggc ttcggatgag       180
     gagggactgg cggcatggga aaaacagcgg caaaaatggg aacggtttgg aactccatgg       240
     atggataagg ttccaaatct atcgggtgaa ataaatcaac cttggattca gccgaagcta       300
     accattggcc agcctaatga taagtacgaa aaggaagcgg atagagttgc taagcaggtc       360
     gttaccaaca ctaattatcc agattttgtc aatgtacccc aaggtagatc tggacagcat       420
     cagggctggg taattgataa cttacaagcg aagccagagg tatttgctaa acagcaagga       480
     ccaaaaagta ttggaggtac actccctgta aatctagagt cagccatcaa ccaggctcgt       540
     gggagtggaa ggcagttaga tgtgagtctc caacaatcta tggggcaggt catgaatgca       600
     gattttagta gggtaagagt gcatacggat gtccagtcag atcgcttgag tcagtcgatt       660
     caagcaaaag catttacaac aggacaggat gtatttttcc gtaagggaga gtatcaaccc       720
     catagtaaat atggacaaga gttaatcgcc cacgaattaa cccatgttgt tcagcaacaa       780
     ggtcagtctg tcagcagttc aaatattcaa agagctattg attggcaggt tcaagattat       840
     ttcttcaaga taggtccaga accaaaatta ggtatcgtga aagatcctaa ttctttatat       900
     caatatttaa atgaatggat taatcgcatt gaaccctggg tgaaatcaat tatagagaat       960
     aaaatcgatg ctaattacta tcaaagccta aagctcgagg ataaaaatga ttttgatagg      1020
     cttaaatatg agaaaaatac ctgggatgaa atagtaaaag gctggaataa gattaaacct      1080
     ggtaaaatta aagaatatat ttcattcctt gctgataaat catctgaaag cttattgagt      1140
     aaagttgtga ttggtagatt aaaggaatct acagggcaat caacagcagg tcagagatat      1200
     acttatagat tttattattt ggaagatgct tttagagcta tcttggcaga agattatagg      1260
     aaagaatcta caaaaaaaga agataaatta gctgatgaag tgctttcaag tgatattgag      1320
     aaacaaatag aattctggat tgttggcttt attaataatt ttactaaaga tgccagatac      1380
     ttaaaagtaa aagaatttat gattgacgca gagtataagg attactttgg aggaaaaata      1440
     tctgatgtac ttgataatcc tgaaaataag agtatttcag aattgatttc ggcattgcat      1500
     gatgcaacaa ctattttatt tgaaatgagt gaggttatat atcaaataga taacccgcaa      1560
     tataagccta gagataaata cttggtccag catggagaaa aaattaactt ttataagtta      1620
     atcgataagg gaggaatatc aaaagaagta gcgaattatg ttgcggttcc tcctgataaa      1680
     gataaagcaa attactacat aaatttgaat aataatagta ataacaataa ttctaattat      1740
     caaaaccagg aagatataaa atatgtccga cctggatact taaatgaatc taagagtgag      1800
     gtattaaaac aactacgcaa gaataaaatg ctagttgaaa taggcccaag ttatacgaca      1860
     ggaagattaa tgcaattaag cgatacattt ggagctggac caaaaacaaa acttgctatt      1920
     gcattggcta tttttgcgtt ttggaataaa ggttatgaca aagcagtctc agggattcat      1980
     cgtttccatt ttgtgatgga catgtgtaaa aactacgtgc ctcagcttaa atatgaaaat      2040
     gagtatccaa attctattgc agagatatgg aattcacttt aa                         2082
//

If you have problems or comments...

PBIL Back to PBIL home page